CAZyme Information: MGYG000003315_00958

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000003315_00958
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		32340.67	4.6912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003315	1388393	MAG	Estonia	Europe

• Gene Location: Start: 926; End: 1825 Strand: -

Full Sequence      

MLSLLSARGIALIADVGPRTCDLLGLERIEDLRDLGLEYLRLDYGFSAQRVAELSGVFRI
VVNASTVSSDEIASWREAGADVTRFAACHNFYPKPYTGLALEDVARTNLRLAALGFEIMA
FVPGDANVRGPVFEGLPTVEAQRGRASKVALNMLELAHGADCDIVLVGDPDLSDAGWAQF
AQVSAGYVDLQCELEPGYAYVRGQIHHDRPDSSVLIFRSQESRTTLKPDSVPTDAGAGLP
RKAGSIAVSNSGYGRYEGELEIARVDLPGDERMNVAGHITPEAMELLPFIKRGFGVRFV

Enzyme Prediction     

No EC number prediction in MGYG000003315_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	2	298	6.3e-86	0.8457142857142858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	1.25e-60	1	182	51	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	5.82e-57	1	299	54	357	Uncharacterized protein [Function unknown].
pfam05913	DUF871	1.81e-26	188	299	5	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
PRK00969	PRK00969	2.24e-04	189	293	191	307	methanogenesis marker 3 protein.
COG4070	COG4070	0.001	177	293	179	306	Uncharacterized protein, methanogenesis marker protein 3, UPF0288 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33651.1	9.78e-215	1	299	52	350
AZH69275.1	3.65e-210	1	299	52	350
ATP53905.1	4.25e-209	1	299	52	350
QOY60728.1	4.46e-127	1	299	52	351
QHQ63310.1	6.39e-101	1	299	52	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0O_A	2.11e-45	27	293	83	352	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]
1X7F_A	1.89e-21	13	290	91	375	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	1.73e-24	1	291	49	336	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003315_00958.