CAZyme Information: MGYG000003314_01020

Basic Information

• Species: Actinobaculum massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinobaculum; Actinobaculum massiliense
• CAZyme ID: MGYG000003314_01020
• CAZy Family: GT39
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000003314_11|CGC6	75692.36	9.5812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003314	1984209	MAG	Finland	Europe

• Gene Location: Start: 368593; End: 370662 Strand: +

Full Sequence      

MSVHGSTQTPAAENDHRSAAAPARSTAKRVRPPAARLRPQAARAYEDELRGRLGLAPLGR
DFLSRAQARTGWIITGVVALLAALIRFIRLGYPPRLIFDETYYVKGANSLLRLGYEADWE
GGNENDPLFAAGDYSMQKTGGDYVVHPPLGKWIMASGQAIFGQQNGFGWRFATALIGAAT
VILLVRVALRLFNSPALAGFAGAAIALDGMGIVMSRTGLLDNILAFFILAGFWAILRDRD
AARAKLAHRVATGQIRANATPADPWGPAVHTRPWILAAGVLLGMACGVKWSGFYPVAVFG
VVVFIWGTLARRAVHTRLWFGAGIFREGLPAFLWLVPASLLTYLAAWIPWFANPNGFMRS
WTPEQVAADMTNYSAPQFSFLPDAFNTWLAYHAKMMEFHTHLSSEHTYMSQPWEWLVQWR
PVSFYWVGSDDEKMKEACGAGRECVEAITSVGNVAVWWPALLALGVVLFAAIVRRDWRAG
AILAGYLATWAPWLLYSNRTIFQFYAVALLPFVCLALAFAAGYVTGSLGRPRARRLPLPV
VVGSSLKIDDGVWQPVKRPESPVSGQDVMVMPVAYPYRARHHQAAGLVGEHAAGEHATGE
HATGEVAVEQHPAGAHAIEQHPADQHLAGQDSINAMPWWHAELTSSGRTLLIGGSIVIAI
FAAFWYPIWTGMTVPRWFWQAHMWLPSWI

Enzyme Prediction     

No EC number prediction in MGYG000003314_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	78	351	4.2e-67	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	4.44e-22	73	336	23	262	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	4.20e-16	77	343	2	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	4.19e-14	67	359	2	241	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	2.03e-11	146	518	136	406	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	1.48e-10	388	519	3	138	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIE82682.1	9.18e-222	45	689	20	589
VEI13043.1	8.69e-201	45	689	16	586
AWE41795.1	1.61e-196	45	539	18	508
AWA43579.1	1.09e-187	46	689	8	563
AZR06782.1	1.09e-187	46	689	8	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.98e-07	73	323	51	257	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.92e-77	71	535	43	477	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.92e-77	71	535	43	477	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.46e-75	63	522	32	458	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	9.03e-54	77	544	40	479	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9UKY4	7.97e-07	46	301	11	255	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
70	92
167	189
191	213
217	236
290	309
329	351
451	473
504	526
650	669