CAZyme Information: MGYG000003313_00707

Basic Information

• Species: QAMM01 sp900552945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp900552945
• CAZyme ID: MGYG000003313_00707
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		37348.31	4.6648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003313	2159275	MAG	Estonia	Europe

• Gene Location: Start: 12556; End: 13521 Strand: -

Full Sequence      

MSQILSLKEKYANYFKIGAAVNAKSIQAHGGLIKEQFNSLTAENATKPSEANPREGVYCL
EEADTIAAFAKENGLALRGHTFVWHNQVPDWWFEGANAEQLMARVEQYMKTMAGRYPQMY
CWDVVNEAVEDKEDYLLRKSPWLEICGEDFIPKAFELARSIMPNTDLYYNDYSEFRPDKC
EKMVKLLTWLKERGAPVDGVGLQCHWQKDYPTYDELCRGMEAFAKLGLKIHITEMDLSVY
DQDDLSAKEKTAEDMELQAKRYGEAFRVFREYHELVDCVTLWGVSDDMTWLDYFPAKRKN
WPLLFDENGQPKEAFYRITDF

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	6	320	2.7e-102	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.91e-111	7	320	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.07e-110	47	318	2	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.85e-87	18	321	39	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE08352.1	2.06e-116	7	320	12	334
QIL68818.1	4.15e-116	7	319	12	333
AZP05644.1	4.87e-112	5	321	1	326
AFE82288.1	5.04e-112	3	321	7	329
AGA16736.1	6.34e-110	5	318	10	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EMC_A	1.59e-107	2	318	2	327	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]
6WQW_A	1.76e-107	5	319	4	327	ChainA, Beta-xylanase [Thermobacillus composti]
4L4O_A	3.80e-104	5	321	11	337	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
4PMD_A	2.45e-103	5	321	11	337	Crystalstructure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose [Caldicellulosiruptor bescii DSM 6725]
4L4P_A	3.08e-103	5	321	11	337	themutant(E139A) structure in complex with xylotriose [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69231	9.02e-107	2	318	3	328	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P23556	2.89e-105	5	321	15	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	2.16e-94	3	321	31	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P45703	3.48e-93	2	320	3	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P40942	3.16e-71	4	320	44	381	Thermostable celloxylanase OS=Thermoclostridium stercorarium OX=1510 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003313_00707.