CAZyme Information: MGYG000003312_03086

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_03086
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		44962.12	7.9477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 8298; End: 9473 Strand: +

Full Sequence      

MRNLMIMAFFLCSSLQLFAENPPAYWQKMADGMSKALIKHFWGANFEGYESRYYFNYGSD
LSNMTTNHYWPQAHAMDVMVDAYIRSSSKEYRNIYPLWWQGAPKFNFSGRPEDPWWNVFV
DDMEWITLTQIRMYESDRKNTKYLEKARQMYNDWISPTWGPEDEAPWFGGITWKTDVAKS
KNACSNGPAALIAARLYNFCDVKGKEDKKKKETYLNEAIKIYTWEKNNLFDRRTSAVYDS
MNGKGEIVKWTFSYNSGTFLGAAHELYKITGDKQYLADAVKAANFVIDHLSTNDGVLSDA
PGGDGGLFHGIFFRYFVKLINEPALDSANRAKFHNYITRCATVMAEQGVNQKTMLYSGRW
RKAPADNESVGLTPQLTGCMLMEAMCVLKPL

Enzyme Prediction     

No EC number prediction in MGYG000003312_03086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	370	3.4e-82	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	2.66e-42	25	379	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.44e-38	47	384	12	366	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	0.003	260	331	91	171	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA09722.1	2.76e-250	1	389	1	406
QUT72195.1	2.76e-250	1	389	1	406
BCA51286.1	2.76e-250	1	389	1	406
QUT39865.1	3.92e-250	1	389	1	406
AAO76990.1	7.90e-250	1	389	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.00e-50	69	389	88	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.96e-49	69	389	89	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.22e-48	69	389	89	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	2.42e-33	26	389	3	341	ChainA, Lin0763 protein [Listeria innocua]
4D4A_A	1.33e-28	13	304	12	281	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999152	0.000165	0.000147	0.000131	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_03086.