CAZyme Information: MGYG000003304_00697

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; QANA01
• CAZyme ID: MGYG000003304_00697
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190	MGYG000003304_313|CGC1	21515.72	6.2535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003304	1057228	MAG	China	Asia

• Gene Location: Start: 3498; End: 4070 Strand: +

Full Sequence      

MKTRKKRTAAALLLLLFLLLSAAGIYGYLRVRFPLRYAELVQTYAAEYELEPSFVLAVIW
AESSFRPEATSHAGARGLMQIMPATGEWIAGKLGIEDFTADRLYDPETNIRLGCWYLGYL
RERFGGNEVKMLAGYNAGPNNVKKWQEEWGEGHEPTAADIPFPETEQYVKKVCNAKLLYA
WLYHLEEAGA

Enzyme Prediction     

No EC number prediction in MGYG000003304_00697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	174	2.8e-32	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.95e-80	34	172	1	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.39e-65	32	184	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.08e-45	52	172	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.03e-38	24	184	126	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.76e-33	44	148	4	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	1.16e-50	30	185	42	196
ADG81833.1	2.97e-49	30	183	32	186
ADL11894.1	7.47e-48	29	186	32	190
QWT54455.1	9.03e-48	30	185	52	208
ACA45057.1	2.47e-46	33	183	28	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.83e-28	30	183	405	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.85e-28	30	183	409	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.89e-28	30	183	415	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.91e-28	30	183	419	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.94e-28	30	183	425	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	3.13e-25	22	181	465	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.13e-25	22	181	465	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.47e-24	22	188	465	634	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	4.49e-22	36	172	1421	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.49e-22	36	172	1421	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.976955	0.019476	0.001591	0.000176	0.000079	0.001748

TMHMM  Annotations     

start	end
9	31