CAZyme Information: MGYG000003295_00968

Basic Information

• Species: CAG-312 sp002437405
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp002437405
• CAZyme ID: MGYG000003295_00968
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000003295_154|CGC1	75641.44	7.8432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003295	2127186	MAG	Mongolia	Asia

• Gene Location: Start: 20115; End: 22160 Strand: +

Full Sequence      

MKNFICILGGLALGINLLVAADYSVKSPDGKISAMVSAENGGLYFSVSADGKVLLDRAGI
GMDTSAGQFGAGAQAKKPEYKKVSQTLENALGTKRKIADNYNEMLVDFGNFSILVRAYDE
AAAYRFQAQADGGELTVKGEKLDLPLAGDTKVIATYTKGVVSSFESPYTRTTPDGMKKAG
ANVASSMPFIFEKAGMKVALVESDVFDYPALRIACREGDKVPHAVFSPLPKTLVQRGNKL
VAGETFDCIAKTSAKRQFPWRAFIAARRDIDLADNDTAYKLATASKIGDSSWIKAGNSTW
DWWVNWNTEGVDFKCGFNEDMCKYYIDFACANDIPYITLDAGWHIGRGPLGENSYYLNSE
EKSAFMEQYNKDENYVNGKPYVDIPSVVKYAHARGKKVLIWSLSKVLYAYPEKALDLFKS
WGVDGLKIDFNDRDDQLMMRHLENITRLAAERQMLIEWHGCPAPAGFSRTYPNAITFEGV
HGAEVNKWAKTITPSHNVDLVFTRMLLGPMDYTPGGMRNSNRRSFAIVKDIPRVQGTRAH
MTAQYVLFFSPLQMISDMPSTYMREEKLLEFIAQTPSVWDETKAIEGEIGKYVVIARRSG
DKWYIGGMCDWDGKEVEIDLSKILPEGGKYLAKIVRDTVNSDGIPEDYKIETKKVSADGK
LKLKMQSGGGFAVRLQPYTLR

Enzyme Prediction     

No EC number prediction in MGYG000003295_00968.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	17	675	9.9e-174	0.9857369255150554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.73e-100	289	576	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	5.67e-44	579	675	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam14508	GH97_N	1.13e-39	27	283	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
cd06589	GH31	7.05e-04	318	451	22	133	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	0.001	336	473	39	173	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64059.1	7.88e-147	1	675	1	662
QCR22730.1	5.17e-141	20	675	20	661
ACB73460.1	2.60e-132	25	675	33	653
QUT47767.1	1.22e-131	16	675	16	660
SCM55445.1	5.10e-131	1	676	1	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	4.18e-112	27	676	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	6.60e-111	27	676	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	5.65e-59	24	676	2	659	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	7.77e-59	24	676	2	659	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	2.03e-58	24	676	2	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.34e-112	1	676	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	4.13e-49	36	672	52	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	1.08e-33	259	676	287	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000430	0.998850	0.000231	0.000149	0.000154	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003295_00968.