CAZyme Information: MGYG000003294_01513

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A
• CAZyme ID: MGYG000003294_01513
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000003294_491|CGC1	42240.42	7.7816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003294	2141670	MAG	Mongolia	Asia

• Gene Location: Start: 1862; End: 3007 Strand: +

Full Sequence      

MKIMFSAGEVSGDVHGEQLASSLLKMDPSLALIGFGGTRMEEAGVRLYENFADYNVMGVW
EVIKNLRRLLKLLDGLTEFMRQEKPDLLVLIDYPDFNWRLAKRAKKLGIPVFSYIPPSAW
AWRKGRARECTKWADEFVAIFPHELPVYEQAGANISFVGNPLVDKVKAELPREKAREYFG
ILEDKTAVLLMPGSRKQEIELLLPAMLAGAKRLLAQKPETMLLLPVADGVREERVRQLIA
EADVPVTITHDKRYSLMGAADAAVATSGTVIMEAALMGLPCVVLYRLSPISYAVGRLLVH
VENFSLPNILLGEQFERELLQDAVTPENIATELMRLYPGEESRNEIVKKLAAACAKLGAP
GASARVAEKILTAARRLSGRI

Enzyme Prediction     

No EC number prediction in MGYG000003294_01513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	356	2.8e-117	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.22e-126	1	376	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.43e-108	1	371	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.63e-89	3	343	1	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.77e-80	3	371	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.14e-42	1	371	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84303.1	1.27e-202	1	380	1	380
AKT54064.1	6.74e-160	1	376	1	376
AME03197.1	3.87e-159	1	376	1	376
ANR70602.1	6.07e-153	1	375	1	375
QNH55245.1	2.46e-152	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.64e-53	1	336	7	344	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.18e-52	1	336	7	344	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.93e-97	3	372	6	376	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.45e-88	2	372	8	378	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.12e-88	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	3.27e-87	2	371	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	2.68e-86	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003294_01513.