CAZyme Information: MGYG000003291_01502

Basic Information

• Species: Faecalibacterium prausnitzii_M
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_M
• CAZyme ID: MGYG000003291_01502
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000003291_243|CGC1	41485.86	4.765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003291	2081808	MAG	Mongolia	Asia

• Gene Location: Start: 6585; End: 7679 Strand: +

Full Sequence      

MWLEYFEQYLDRVFPRFLNEKPWNYKDDLCMVGAEDLYCATGSESWREPVRRNASFLMDD
TGRVANWVPGEHNIDKVSFGKSMRILRDVTGETRWAEGVERAYRILADYPRTVTGNFWHK
DIYPDQVWLDGLYMGMPFYAACLAENGEDRWDDILDQFASAHKLLWDEQLGLYRHANDCS
RKMEWADPVTGQSPVVWLRAEGWFLMALADTYEIAKDRTPRAGELCTLLKNALDRLLPYQ
VADTGMFLQVVDRADLTGNYSETSGSAMVAYALMKGARLGMLPPEYGEKGSRVLDGIRDT
YLKKGEQGWELHGICASAGLGPGPDNRTDRTGTPEYYLSEKQMVDNQHGAAACMMAVSEQ
LRRA

Enzyme Prediction     

No EC number prediction in MGYG000003291_01502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	20	361	3.4e-80	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.91e-66	4	362	14	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.38e-51	8	363	12	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ99429.1	4.43e-192	1	363	1	365
ANU45824.1	4.43e-192	1	363	1	365
QIX93226.1	6.60e-187	1	363	1	365
ADL69867.1	2.10e-88	7	361	5	358
AGB20020.1	2.17e-88	7	362	5	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.48e-63	23	359	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.78e-50	23	359	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.58e-50	23	359	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	1.63e-10	95	363	119	371	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.72e-50	23	359	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.33e-38	134	361	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.33e-38	134	361	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003291_01502.