CAZyme Information: MGYG000003279_00005

Basic Information

• Species: Alistipes sp900541585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900541585
• CAZyme ID: MGYG000003279_00005
• CAZy Family: GT80
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		55999.83	4.4395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003279	3216844	MAG	United States	North America

• Gene Location: Start: 5015; End: 6526 Strand: -

Full Sequence      

MKRFFRLLLMLGLGAGAWSCADDGTPTVSINGGTDFLSLDHLARSGKITVNAPAPWSVAL
ASENYGQDQKPDWLTLSAEDGPEGYSEIDVTFAENPGPARSALLLFTCNGKTSAFTVSQS
AGGTGFDAPDYYFYISVGTMPTLYSGLHLLSHDKPSYVSYERASTFDAAEFPSRAVVYPV
ADPTGHATNEELRTMSEAMKRRILEINAENPTAVFGLWVDDLRCRLGYDWFVAQGIDSAR
VKVTMLSDGTATYNNFHNYFGDAATAEQNWNDYAAEVEALDWDHGGRYPETRAPEEFASY
TWPYYLSTRPDYRLMLQNRSLMESSCPFITDRLAEMKMESVQPYELLTALPEASKQQFYR
MAKFDYARFAELFDLSPKKNLIIIGTSHSSAASEQQQAAYVERIMQQYGSDYDIFFKPHP
ADSSSAGYPDRFEGLTLLPGQMPFEIFVWALLDKIDMIGGYPSTTFISVPLDKVGFLFAA
GADGLVRPLNILFRDAANVEWIQ

Enzyme Prediction     

No EC number prediction in MGYG000003279_00005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT80	341	484	1.6e-43	0.40369393139841686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14948	BACON	3.54e-10	34	120	6	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam11477	PM0188	0.001	409	478	284	353	Sialyltransferase PMO188. PMO188 is a sialyltransferase from P.multocida. It transfers sialic acid from cytidine 5'-monophosphonuraminic acid to an acceptor sugar. It has important catalytic residues such as Asp141, His311, Glu338, Ser355 and Ser356.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01105.1	7.16e-253	1	503	1	498
BBL09010.1	8.88e-94	315	503	1	189
BBL11802.1	8.88e-94	315	503	1	189
AWK81336.1	1.35e-09	243	483	224	465
BAA25316.1	8.88e-09	128	483	111	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R83_A	2.63e-10	128	483	117	471	Crystalstructure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_B Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_C Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_D Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R84_A Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_B Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_C Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_D Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae]
4R9V_A	6.38e-10	134	483	26	374	Crystalstructure of sialyltransferase from photobacterium damselae, residues 113-497 corresponding to the gt-b domain [Photobacterium damselae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001144	0.192919	0.805465	0.000179	0.000151	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003279_00005.