CAZyme Information: MGYG000003277_02393

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_02393
• CAZy Family: GH5
• CAZyme Description: Endoglucanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000003277_127|CGC2	37508.07	4.4823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 23010; End: 24020 Strand: -

Full Sequence      

MKTFSSLTLLLLTLPLSFSSCGSSARQNDTAEADTIVAGVSPLHVEGRYLLNADGDTVVL
TGPSLGWHGNWGRFYNEGTIKALKEKWGANVTRAAIGAHKAGDITKAYDPDSAYSVNLAS
TVIDAAIANDMYIICDWHSHDNTLDNAKEFFTVMTEKYGNSPNVIYEIWNEPLEIPWQEV
KDYANELIPVIRKNAPSSVIIVGTPRWDQEVDVAAESPLEFDNLLYSLHFYADTHKEWNR
SKAEKAIGMGLPLIISECGSMNHLGDGDINYESWNDWIDFADKNKLSVLMWDIADKDETC
SMLTPDAPDNGMEWTDAQLKPWAKLAQETIKKRNNR

Enzyme Prediction     

No EC number prediction in MGYG000003277_02393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	288	5.2e-86	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.99e-48	51	297	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.92e-04	28	203	32	227	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72662.1	4.20e-172	21	336	20	335
QCD38972.1	4.20e-172	21	336	20	335
AWW31171.1	3.28e-102	2	327	3	316
QDH78944.1	2.50e-97	2	330	3	319
QIK58758.1	7.20e-96	16	334	16	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IHS_A	3.72e-67	35	334	27	324	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1EGZ_A	2.57e-65	40	307	2	270	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
6GJF_A	1.43e-61	43	332	13	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1TVN_A	1.19e-60	40	320	2	285	Cellulasecel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVN_B Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVP_A Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis],1TVP_B Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis]
5WH8_A	1.41e-60	43	314	14	293	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07103	1.45e-63	38	307	43	313	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
O85465	1.52e-59	1	331	1	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P10475	4.38e-57	7	330	9	329	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P06565	8.74e-57	28	331	22	327	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	1.69e-56	31	331	30	330	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003277_02393.