CAZyme Information: MGYG000003275_00838

Basic Information

• Species: Collinsella sp900762325
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900762325
• CAZyme ID: MGYG000003275_00838
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000003275_32|CGC1	30194.31	6.0942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003275	2118625	MAG	Peru	South America

• Gene Location: Start: 18121; End: 18918 Strand: -

Full Sequence      

MSSEMKIPKTIHYIWFGGKPLPPMAERCINSWKEHCPDYEIVRWDEDSFDSGGNRYFEEA
LAAKKWAFASDYARLKVLVEHGGIYMDTDVEVLRPLDRFLQEDAFSGFETPSRISTGLMA
CRRSFPLFERLLQDYEGRAFVLSDGSYDETTNVVAITNACLELGLELNGGKQTVEGFTLY
PKDFFSPKDHKTRQVHLTENTYVIHHFDGSWLPDKTVAYKQAKESLIATHPKMPYSLASG
LALLGLCIEAGSIKPYKVWTENRGR

Enzyme Prediction     

No EC number prediction in MGYG000003275_00838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	102	4.7e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.12e-23	2	136	77	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.24e-17	27	105	6	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.15e-09	2	135	41	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	3.55e-06	9	49	1	41	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	8.27e-04	45	123	147	221	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST53065.1	3.97e-88	7	214	2	209
QUT95860.1	5.63e-88	7	214	2	209
BBK91625.1	9.59e-86	7	214	2	209
QJE27088.1	3.10e-83	7	214	2	209
QYR65866.1	2.66e-75	7	226	2	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003275_00838.