CAZyme Information: MGYG000003268_00136

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_00136
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000003268_23|CGC1	57398.74	4.7984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 6250; End: 7782 Strand: -

Full Sequence      

MKQRHNILKAGWLFLTAVLLVFVASCKSDDDAKVTGLSVTRDGTTIQDLHFNSSEMTTML
GVTTDGEWTAEIPAADTTWLHITPHAGPGWAYTDTAATNRNAYIKVSVESNREAQRTSQI
TLKAGNLSQIVTVTQDGTSTDPNDPFESAWDMVRNLKMGYNLGNTLDSNPEGDWWDPTGK
TTKDYETAWKQPVTTQQIIDDIHAQGFNIIRVPVTWAPHMDANNNIDATWMARVKEVVDY
CLKDGGYCIINVMHDTGTRSKEKQKLGGWLYADMASYPEQTVRYQAIWKQIAETFKDYDE
HLIFESFNEILDEKSSWSAPAPGDDSYEAVNKLQQDFVNVVRATGGNNEYRNLAITTYSA
TGNENTTNHGDPLAELTLPKDVHSNHIYLSIHSYDPYNFCNNNSGKDANGKEYDYNKNIF
DDECMTAIDGVVNRVSKRANDLNIPFIFGEFGAIDEAKSMDERVKYATYVSTKLHGLHTT
GLWWMGLYNRSKNEWYEQRIVDALKAGFGI

Enzyme Prediction     

No EC number prediction in MGYG000003268_00136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	185	485	9.6e-88	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.95e-42	177	484	7	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.75e-13	152	457	47	327	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	5.25e-11	47	136	7	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	7.37e-05	49	138	9	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	0.002	69	135	1	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPB75690.1	1.15e-203	13	504	1	497
QRX63738.1	3.36e-92	1	504	2	475
AAA22909.1	1.94e-80	127	508	1	361
AEX97596.1	8.18e-80	144	504	30	375
AEV46038.1	5.45e-77	160	473	1	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	1.61e-80	147	508	11	351	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	1.26e-79	147	508	11	351	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
6D2W_A	1.36e-77	127	508	414	774	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3VDH_A	9.18e-76	147	508	11	351	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6XSO_A	2.30e-64	146	394	19	271	GH5-4broad specificity endoglucanase from an uncultured bacterium [uncultured bacterium],6XSO_B GH5-4 broad specificity endoglucanase from an uncultured bacterium [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	8.14e-58	148	508	38	378	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	5.49e-53	148	504	26	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P23661	4.59e-51	138	505	58	397	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P10477	1.11e-50	148	510	56	387	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P17901	9.99e-50	143	504	41	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000136	0.999877	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24