CAZyme Information: MGYG000003260_00830

Basic Information

• Species: Collinsella sp900761945
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900761945
• CAZyme ID: MGYG000003260_00830
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173		19568.49	8.4018

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003260	1586321	MAG	United States	North America

• Gene Location: Start: 4921; End: 5442 Strand: -

Full Sequence      

MPKTRFFTWYRVAPLAVVLVFGFISLVYSYAPAAFFKPLYPIDYEAYVKQSSISHNLDPY
LVCAVIKSESNWDPEAESNQGARGLMQLMPETAQDMIAKGLVDGSEYSADNLNDPATNIE
FGCAYLSYLLTYFTGRLTAPLPPITPAWAMSTDGRSRARRFIMQSPFPRRRRI

Enzyme Prediction     

No EC number prediction in MGYG000003260_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	56	137	6.1e-19	0.5333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.39e-44	41	137	1	95	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.76e-30	39	137	1	97	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.46e-24	59	137	1	71	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	1.16e-19	46	135	1	92	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	8.46e-19	40	173	135	272	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69985.1	1.09e-93	1	135	1	135
QIA32839.1	4.68e-88	1	135	1	135
ATP53198.1	1.04e-84	1	135	1	135
AEB06732.1	8.36e-51	9	135	10	136
QWT18301.1	1.64e-38	22	135	2	115

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.28e-11	40	167	449	581	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	3.19e-11	40	167	449	581	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
4C5F_A	1.17e-10	44	140	174	270	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	2.97e-10	44	140	174	270	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GHZ_A	6.74e-08	49	131	27	109	Structureof Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12],6GHZ_B Structure of Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	1.74e-11	40	141	1418	1508	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.74e-11	40	141	1418	1508	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC4	7.04e-11	40	167	476	608	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	7.04e-11	40	167	476	608	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	2.45e-10	45	141	61	146	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999874	0.000114	0.000004	0.000001	0.000000	0.000019

TMHMM  Annotations     

start	end
12	34