CAZyme Information: MGYG000003255_01358

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_01358
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		35639.83	6.3818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 14; End: 997 Strand: +

Full Sequence      

MQRYIDYLGTRADNNIVAYGLGDWFDIAPGKPGRSKLTSNGVPATATYYYDVLTMSKIAG
LLGKPDDAARYSALAARIKDSYNKAFFHADKGYYDRNSQTANAISLHFGLVPSGREADVL
NALVDDIRQRGNALTAGDIGYRYVLRALEEGGRTDVIFDMNSHYDKPGYGWQLAHGATAL
TESWQAYGFVSNNHLMLGHLMEWLYSGLGGIRQADNSIAFHNIEINPMPVGDVNYASTTY
QTPYGEVSCRWERKPGMYTMKLTVPANSAACVTLPASTASQVSDYGTPLADAEGISNIMP
GSRTGNPSLTFTAASGTYNFQVANPVW

Enzyme Prediction     

No EC number prediction in MGYG000003255_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	1	274	3.3e-75	0.5396825396825397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.44e-56	1	208	127	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.96e-13	210	280	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.26e-05	2	117	369	501	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	7.57e-05	46	96	581	633	alpha-glucosidase; Provisional
COG2833	COG2833	0.005	66	142	118	200	Uncharacterized conserved protein, contains ferritin-like DUF455 domain [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50137.1	1.01e-127	1	322	610	927
BCG53837.1	6.47e-116	1	323	593	911
QNL36667.1	7.35e-116	1	322	600	918
QDH54694.1	2.20e-114	1	322	600	918
ANU58580.1	2.74e-113	1	324	606	925

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.59e-38	2	275	590	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	5.26e-21	23	275	580	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.40e-28	23	321	620	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.08e-23	1	276	593	880	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_01358.