CAZyme Information: MGYG000003255_00666

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_00666
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		71658.43	4.8444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 2978; End: 4891 Strand: -

Full Sequence      

MNHLIPSVLLLLVLFSCKGSDIYQLASPDGRLYVKIEQTTDSGLMYRFFIDNKLVIGSSP
LGYRLDGGRMLPDMQYKIVNNDYVAVNSEWHPVWGKRSVVPDVYNQLTLEFESKKDSARF
VLDVRLYDDGFAFRYNIPEISEEVCADEVTGFNYVENPVAWFYNGEDANYGPVRLTEVDT
VRSPNVTLQLSDDLFLNMHEACLMQGDPLMLDSEKGEHSLVVASSAGVLGKLKSGYTSAW
RVVMVGNTPGALVDSHLLELLNPDPDMDFSWVKPGIAVWDWRINGAEYNKFTYTMSYPSW
VRMVDFAAEQGFGYLVLDANWYGPEFDSDSNPTNGHKAADVQRLLAYAKEKGVGVWLYLN
DIGGRKFPIEETLSQYGRWGASGVKYGFMEGSPEEKNRWTQKITELCAKNRLLVDFHDGP
VHPYGQMRTWPNAVTREYCHAQLDAHRVFTPSTFCTSVFVNMVAGPLDMNNGMFDLRQGP
TTRIDENQPVPSTLVSEAARTLIVFSGVTILPDIPEYYKKYTALLQFLSAQKMPWKESRT
LAGKIGEYVVMMRQTDEAILVGAATNESGRIIDIPLDFLDDLQYDVLIIEDGDGAHYLTN
RETLKESRRKVSKQDSIKLTLAPGGGACLIFKPVTSK

Enzyme Prediction     

No EC number prediction in MGYG000003255_00666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	11	630	1.8e-136	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	7.94e-52	27	263	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	8.75e-49	268	529	1	275	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	3.97e-29	535	632	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75478.1	0.0	2	629	4	636
BBE16916.1	2.13e-277	25	634	28	639
QDO68310.1	1.15e-272	27	629	26	627
QUT49475.1	3.91e-233	252	636	1	387
ABQ06816.1	7.72e-229	25	632	32	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	1.29e-58	27	632	5	659	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	1.29e-58	27	632	5	659	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.77e-58	27	632	5	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5E1Q_A	4.63e-52	27	632	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	3.48e-51	27	632	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	4.18e-52	1	632	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	4.32e-44	26	630	44	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	4.86e-41	24	637	24	729	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000417	0.409074	0.590015	0.000158	0.000168	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_00666.