CAZyme Information: MGYG000003255_00664

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_00664
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30076.16	6.4927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 12; End: 815 Strand: +

Full Sequence      

MEFTEADTTQKNAQGRLAPGVYRAVFNLKRTGDTFLNFSTWGKGLVYVNGHPMGRIWEIG
PQQTLYMPGCWLKKGENEVLVFDILGPRQLKSEGLRTPLLDQLLLPKPPTHRKEGQTLDL
TGEKPVLSAQFEPGNGWQEASFKTPVTGRYVCLEAIDAINGGQTASIAELYLLDNNGQRL
SREPWTVFYADSEDMKKSNCSADKVFDLQESTYWKTAKNIDFPHHIVIDLGNTQTVTGLQ
YLPRMESDVPGAIKNYRIYVSENPFKL

Enzyme Prediction     

No EC number prediction in MGYG000003255_00664.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	1.50e-09	202	263	14	73	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.55e-05	206	263	29	85	Substituted updates: Jan 31, 2002
COG1874	GanA	6.78e-04	30	87	536	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35705.1	5.21e-127	2	266	840	1104
AVM53495.1	6.64e-127	16	265	540	789
QUT33927.1	7.92e-126	11	265	850	1104
QUU00371.1	7.92e-126	11	265	850	1104
BBK85653.1	7.92e-126	11	265	850	1104

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	1.46e-88	10	267	521	779	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	4.60e-35	10	116	501	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	1.84e-18	1	84	501	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	9.06e-14	19	103	506	590	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
1W8N_A	5.56e-07	191	263	469	544	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3UPY5	3.85e-16	15	83	553	613	Beta-galactosidase-1-like protein 2 OS=Mus musculus OX=10090 GN=Glb1l2 PE=1 SV=1
A2RSQ1	3.49e-14	11	83	534	613	Beta-galactosidase-1-like protein 3 OS=Mus musculus OX=10090 GN=Glb1l3 PE=1 SV=1
Q8IW92	4.67e-14	33	83	563	613	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1
Q5XIL5	2.80e-13	11	83	534	613	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1
Q54GE1	3.86e-13	19	85	585	654	Beta-galactosidase 1 OS=Dictyostelium discoideum OX=44689 GN=glb1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_00664.