CAZyme Information: MGYG000003252_05634

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_05634
• CAZy Family: GH76
• CAZyme Description: Cellobiose 2-epimerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43242.12	7.5871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 40446; End: 41579 Strand: +

Full Sequence      

MLFCLTSAVGKTPGNARYLSIADSILYNVLNLYQTNDGLLTETYPVNPDQKITYLAGGTQ
QNGTLKASFLWPYSGMMSGCVALYKATGDKKYKKILDKKILPGMEQYWDESRLPACYQSY
PVKYGQHGRYYDDNIWIALDYCDYYQLTRKPASLEKAVALYQYIYSGWSDEMGGGIFWCE
QQKEAKHTCSNAPSTVLGVKLYRLTKDAKYLEKAKETYAWTKKHLCDPTDHLYWDNVNLK
GKVSKEKYAYNSGQMIQAGVLLYEETGDEQYLRDAQQTAAGTDAFFRTKADMKDPTAKVH
KDMAWFNVILFRGLKALYKVDKNPVYVDAMVGNALHAWENYRDENGLLGRDWSGHNKEQY
KWLLDNACLIEFFAEIN

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	59	360	1.4e-78	0.8268156424581006

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.47e-27	130	353	85	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.45e-16	129	352	90	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
COG1331	YyaL	2.74e-04	200	287	422	505	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam07470	Glyco_hydro_88	0.008	199	362	39	185	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78429.1	4.69e-283	1	376	1	376
QDM11358.1	6.59e-283	1	376	10	385
AAO77738.1	6.59e-283	1	376	10	385
QMW85074.1	6.59e-283	1	376	10	385
QIU94021.1	9.73e-283	1	377	10	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	8.55e-241	18	377	4	363	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	1.13e-56	70	374	169	489	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	1.26e-51	68	376	43	367	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	4.53e-28	103	377	112	389	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	5.26e-26	103	377	112	389	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996634	0.003356	0.000052	0.000011	0.000005	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_05634.