CAZyme Information: MGYG000003252_05081

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_05081
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000003252_480|CGC1	49398.64	4.3282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 1966; End: 3300 Strand: -

Full Sequence      

MKTIHTLLAAMTIAMLAISCENEFDVSDKADSLISVTVNTLNNQAAYNVGETAQAELWIQ
RGGLKDASGKVQFVVDPLLLDSLNQEDKTNYELLPENCYEMTNTEFTVDKNELCGYITYH
PEKILALSAYNETKYVLPLRLISNDLAINPARNTSFLAFTILEPIVHISNAGVYNINPDL
TSTMDIQIGVPFTNKWDILCNLTEDLSLIDEYNQINKVNFTLLPENAYTAPESVTLQEGV
SQITASYQLKNNLVPGNYILPIKIGSITASQGGVPNNSLVIDEESNVLFCIVKEGNKINK
SGWEVIECSSEHAGNEATYMIDDNESTYWHCKFKNEAGSSVPPFHFIIDMKKEITIAQID
LLNRGDGAANNIKWVEFYASNNNSEWDKIGAGDFNDEGTRATFRYYVKSTKARYLKLIIP
EGYGNNCPPAAIRELTVYGLEGNN

Enzyme Prediction     

No EC number prediction in MGYG000003252_05081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	309	436	3.4e-18	0.9112903225806451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	2.74e-18	306	435	2	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam08522	DUF1735	2.93e-13	47	148	21	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam08522	DUF1735	7.20e-10	173	268	18	117	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW86943.1	0.0	1	444	1	444
QUU08575.1	4.14e-218	1	439	1	440
ASM66238.1	4.14e-218	1	439	1	440
QQT77186.1	4.14e-218	1	439	1	440
QRP57568.1	4.14e-218	1	439	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GGL_A	2.76e-36	289	439	6	157	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
2KD7_A	8.25e-32	295	439	2	147	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3F2Z_A	2.21e-30	295	439	2	147	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000065	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_05081.