CAZyme Information: MGYG000003252_04435

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_04435
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734		84669.17	5.6338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 79768; End: 81972 Strand: +

Full Sequence      

MEKKYKILLAALSLASSTFAQTWIWYPGDYEIWLGNQMNNRRTERGVFFPPFWKTDSHYV
VVEFSKQLNLAEPEEIFIAAEGKYSVKLNGKLQFGMPETMTLPAGKHNLNIKVWNQSTPP
AIYVKGKTVNSDSSWRVTYEDKEWIDESGKASDTSATIYMDAGCWNFDGATQRPSQFKLM
REPHQPVSKAEQSEGGILYDFGKETFGYITLKNLSGKGTIEIYYGESPEEAKDKAYCETL
DKLLLEKGQMTDLAIRSASPLNDSDNEYTLENSKAFRYVYIAHEPGVTIGDVSMQYEYLP
EEYRGNFRCNDEELNRIWEVGAYTMHLTTREFFIDGIKRDRWVWSGDAIQSYLMNYYLFF
DSESVKRTIWLLRGKDPVTSHSNTIMDYTFYWFLSVYDYYMYSGDRHFVTQLYPRMQTMM
DYVLGRTNKNGMVEGMTGDWVFVDWADGYLDKKGELSFEQILFCRSLETMALCADLVGDA
DSKQKYEKLADVLKSKLEPTFWNDQKQAFVHNCVNGLQSDAVTRYANMFSVFFQYLDDKK
QQAIKNSVLLNDSILKITTPYMRFYELEALCALGEQEAVMKEMKAYWGGMLKEGATSFWE
KYNPEETGTQHLAMYGRPYGKSLCHAWGASPIYLLGKYYLGVKPVKEGYKEFSIAPVLGG
LKWMEGTVPTPNGDIHIYMDKKTIKVKATEGKGYLTIKSSRQPKANIGTAEKVSENTWRL
WLDSPEERIITYRL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	192	685	2e-115	0.9623015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.34e-26	305	638	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.32e-05	641	677	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.37e-05	260	505	193	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG4354	COG4354	1.87e-04	394	503	449	566	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam04685	DUF608	6.90e-04	394	503	106	212	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK65632.1	0.0	1	734	1	734
QRQ56933.1	0.0	1	734	1	734
SCV09640.1	0.0	1	734	1	734
QUT23612.1	0.0	1	734	25	758
ALJ45306.1	0.0	1	734	1	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	0.0	7	734	4	731	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.62e-48	191	713	433	945	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.55e-27	310	638	212	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.83e-16	188	676	598	1109	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998827	0.000182	0.000194	0.000180	0.000170

TMHMM  Annotations     

start	end
7	26