CAZyme Information: MGYG000003249_01976

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_01976
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000003249_354|CGC1	41972.28	9.0571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 302; End: 1414 Strand: -

Full Sequence      

MKKIWILAGEASGDLYGARFARKLRAEAAERGETVEIAGMGGPEMKRADIDIRVDSTELG
VVGVIEVVKHLFTFVRIFFQLVRQAKHERPDSVVLIDYPGFNLLFAVTMYHYKIPVIWYV
CPHLWVWGKWRLPILAKVCTKMLVIFPFEVEVFAHTRLNVEFVGHPLVEIVAERRDPNII
RDPNAFLLLPGSRTMEVTRLLIPMLDTVTVLKQRHPELTFHLSAPRQKIADLCTRIYEEY
RRKHPDCPAVGITVGDTGYWQQKAGTGLAASGTVTVESAIAGLPLVVGYRLNWITILLAS
LVVRLYRGFFTMVNIIANRAVFEEFLQHHFCAKELVPAVERILPDGPRRSEVESGMAEVT
SLLSFPEKRK

Enzyme Prediction     

No EC number prediction in MGYG000003249_01976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	361	1e-91	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.60e-92	1	359	1	358	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.07e-91	1	363	1	359	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	5.91e-67	4	327	1	323	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.78e-57	4	327	8	329	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.09e-36	1	341	1	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45461.1	1.02e-193	2	364	12	374
QSH40861.1	1.06e-160	2	364	6	368
QUE51553.1	1.76e-61	3	366	4	360
QHI67954.1	1.30e-60	2	369	3	366
SEH72811.1	1.88e-60	3	363	2	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.33e-29	4	346	9	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.33e-29	4	346	9	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1INL4	1.01e-54	1	359	1	353	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q39T49	2.20e-48	2	363	7	363	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	3.08e-48	3	363	8	363	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.16e-47	2	366	4	364	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q02AZ6	2.17e-47	1	364	1	356	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_01976.