CAZyme Information: MGYG000003245_01969

Basic Information

• Species: Mediterraneibacter sp900761655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900761655
• CAZyme ID: MGYG000003245_01969
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000003245_292|CGC1	55731.45	4.7481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003245	2245318	MAG	United States	North America

• Gene Location: Start: 11351; End: 12793 Strand: +

Full Sequence      

MPAEKKLMTKKMYLEQLRQFGSVIDQAQNDILRLGYHLQPPVGWLNDPNGLCRIGDDYHI
YFQYSPFNAEGGNGLWGHMTSKDLLHFQEHEPAVYPDCAWDQHGAYSGSAYEEDGTYYVF
YTGNVKYTDKKYDYTTAGREQNVILITSRDGYDFTEKELLMTNDDFPEDMSKHVRDPQVI
RKNGQYYMLLGARTLTDKGCVLLYESSDLRHWEYKLRFTTADTFGYMWECPNYAEVNGQG
FLIACPQGLPSQGLDYANTYQCGAFKLDYRFGETDYRIGGFRELDRGFDFYAPQILQDKQ
ERTLLIGWMGMPDSDYDNAPTLKNGWQHCLTIPRELYLTKEGQLAQRPIRELETIRGERH
EEHFSGTFRQNVPLLFDMELDFEKCESFTIRIRENAVLTYDKDALLLDISRCGRGRKTRG
VHLQNIRNIRILSDSSTLEIFVNDGEEVFTTRIYDSMTDLSCEMTEGNAQGSVVWYELQP

Enzyme Prediction     

No EC number prediction in MGYG000003245_01969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	348	6.4e-91	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.52e-151	43	338	1	287	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	7.68e-145	25	454	6	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.15e-131	25	454	21	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	8.37e-114	37	445	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.53e-108	37	348	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM14308.1	9.27e-163	8	478	1	471
AVQ19049.1	1.82e-162	8	466	1	442
QCP34478.1	3.21e-160	25	480	25	480
AQP38736.1	1.90e-159	33	479	33	477
QMW71993.1	2.60e-159	25	480	25	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.49e-69	36	454	29	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	3.06e-57	26	454	26	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.23e-52	29	454	45	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
1UYP_A	1.04e-51	31	454	1	405	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
7BWC_A	1.73e-51	29	454	45	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	6.02e-95	27	454	23	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	4.40e-84	36	454	30	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
Q05936	8.00e-82	25	479	26	490	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P37075	1.14e-80	36	454	30	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
Q56660	4.10e-77	36	454	97	511	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003245_01969.