CAZyme Information: MGYG000003237_00417

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_00417
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		93729.13	6.3525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 47250; End: 49802 Strand: +

Full Sequence      

MSILAVTGVQVNDRDCTGELLFVASPQVEFSWRIETDSPGSRQCGYQIVATDADGRLLWD
SGRVAGNACRGVPWRGAGLKAGDRVSFRIRVFDRTGNPSPFSVENAFAVALQSPADWNGA
RWVRFAGNRCAAAAPAPHFRREFTVGDGLRRAVLSITARGVFEPSLDGTRIGGDLLAPGW
TDFRKQIQFLSCDLTDRLPPGRHALGVILAEGWCCGNLTVLRMRNVYHPHPELLAHLELV
YRDGRRESVVTDSGWKTATGPILGSDLYDGEDYDARLEMPGWNTPGFDDGAWEAARESGG
VAETPRLVQKSAPPVRYMRELKPVRLLRPKKDVCIWDFGQNFSGTFRVCPRGIPGRRYTF
ATAEILEPDGSLYTLNYRGARSQDSYICAGPVEQAAEYVPKFTFHGFRYLQIDGWQFDRI
PPEELDVTALVMYSAMPDRCRFSCGDSGVNRLWLNALWGQRSNFLEIPTDCPQRDERLGW
TGDAQIFAPAAMLNMDCLAFFRKYLRDIRDGFTPEGAAPSIAPAVLHINDGAAGWGDAVT
MLPCALYRHYGSTAVLTENYEAMKSALNYQLSRSEEFIIGGEGQFGDWLAPEATPPELVA
TAYFAHCAETVAEAAGILRIPGDRDHFLKLAENAGRAFRQKFTDGAGLVRPATQTALVLA
LAFGLVAPGTVSENLDLLEQRIRGNGTKLSTGFLGTALILPTLARFGRTRCAYDLLLQEE
CPSWLFQVRQGATTFWERWDGFSQEKGFGDVSMNSFNHYAYGAVSEFLVSWLAGIHYRHD
GLVFEIIPDRRFSPVKAVFDSPFGRIASSWSLTPGGGLHWEAEVPPGLPASARLPGGREL
PLAPGRHTLS

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	329	831	1.2e-144	0.9861111111111112
CBM67	120	305	3.9e-37	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.93e-122	442	768	6	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.19e-53	149	316	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.00e-26	328	433	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.09e-06	788	839	18	68	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43513.1	0.0	1	850	1	850
AHF91525.1	4.81e-204	30	849	32	896
ABU57965.1	2.40e-198	31	835	28	851
ABQ91107.1	3.02e-197	31	835	28	852
QXD15384.1	1.56e-195	31	850	60	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.95e-161	110	835	280	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.36e-139	21	847	16	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	9.46e-132	30	813	53	878	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.16e-160	110	835	280	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.49e-159	30	835	57	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.64e-144	22	816	47	861	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.00e-86	30	825	53	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_00417.