CAZyme Information: MGYG000003235_01000

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales
• CAZyme ID: MGYG000003235_01000
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
940		106219.93	5.0838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003235	1263407	MAG	United States	North America

• Gene Location: Start: 122; End: 2944 Strand: -

Full Sequence      

MPAHAGYLSLNGGDAFERKTLTVDLGGIKHVDDIILYGARPFFMPERVPDAPGYLYPVKF
TLSVAKNEDFSDEIIIFDATEPVPNPGVQPVYYSVNGEIRFIRIALKQMQEREKGVYAFS
FSQLEAMSGNENVALGCKVTATDSQEDEFFGVSKLTDGSVSWHTAGRAKSLKQPLFRREF
YAKAKVKKAYLYASALGVMEISLNGNRVSDSYLSPEWTEYTQYSQYRCYDVSDKIAEGGN
ALGIALGDGWYAGRVGMANVFGPGVLRGIYGGETPKFFMQLEIEYENGGREKIVSDDKFQ
STIRSPYISTDIYDGEVYDARLYAEGWDKFGFKTGRDWQNARAAEEIDVALVPQISEPIG
EIERLKAVKITKNSAGEYIVDFGKVHTGLISARLRGEEGRRVTFRYAEALNSRGDCYFAN
MRGAIPRDVYICSGKGEEIYSPKFTYRGYRYVQIRGLSYEPKIEDFESIFISSAMERVGF
YNFDEPYFNRLSEAVCNTVRCNLMGVQTDVCERDERLGWNMDGFEDSRYYLDSGRFFMHN
SRERERIECPEGMRPEQTPCALKMYTGILQIDAKNPRIMYEHYGDKRLIEECYGIAKNAV
LKMEKTYPELIVETVGYVDWLNGDTVLIDGYPESGAQIGAPCYQTVMFYEQADCVSYFAK
ILGNREDEEYFADLRDRIGENFRKRFYDENTGILERDTQSGYAISLFHGILSGKAGEKGA
MNLEKALERYGNRFSTGAYTIGKMLSALSENGRHKLAQEVALNPKAPSFRYMLDCGATSI
WERWDSYIAEKPHLQVKKRWQAEREELTYISEDGFGDIGMNSLCHLEFTCVGVWLAEKLA
GFKIEDEYAGKRFFVNVKPEGSVKRAETSYKLPCGRVNFEWKSSGAETELRITVPVGAKA
AVTMPGSAVYEGETELAFAEKADGKVRFELSSGSYKLVAR

Enzyme Prediction     

No EC number prediction in MGYG000003235_01000.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	370	903	8.1e-103	0.996031746031746
CBM67	162	346	3.1e-27	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.81e-58	476	835	1	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.35e-52	184	363	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.68e-29	376	472	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.18e-06	851	912	10	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ99691.1	7.79e-113	2	935	29	968
ARN56952.1	4.09e-109	177	936	334	1071
QTH46256.1	1.17e-108	177	939	145	908
QJD83760.1	1.25e-107	177	939	145	911
ASA21372.1	2.03e-106	174	940	138	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.80e-89	185	940	315	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.17e-86	174	935	177	937	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	7.44e-73	176	906	134	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.55e-88	185	936	315	1027	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.88e-70	17	905	34	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	8.26e-64	151	905	139	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.47e-49	176	900	187	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003235_01000.