CAZyme Information: MGYG000003226_00652

Basic Information

• Species: QALS01 sp900552625
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900552625
• CAZyme ID: MGYG000003226_00652
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		61924.7	9.13

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003226	3084338	MAG	United States	North America

• Gene Location: Start: 7770; End: 9419 Strand: -

Full Sequence      

MKKRPTLYIIIIAVWLGCVALLGYALANIIIHLNGYSAVKQGFIISLLVINTAVLAILWF
GSIKDFIFSAAYAVLHKKLDRHYREIEKCERGGEDEPRFLLLYCTCNDFNAKALSACRKQ
NYSNFRTVILDDSTKAEYRREVNKYMAQHKNVEVVRREDKTGYKAGNLNHYLQGRTDYDY
FIVLDSDEVIPPDYIEKILKYFHYDPKCGAVQARHAAQKGENVFQRLMGLCVGSNGTTVQ
VIKNFYGANALIGHGMTISRACYEATGGFPLVVAEDISFAVEIKNAGMDIVYAPDILCFE
EFPVNYVSLKKRQCKWTQGNLEYMRKYDRDINRSKMRWFEKLDIKLSHYSLPIVPVLSFL
LAICTIALGFLGYPVIRYSLGIYAVMILFLCSPLIPDLFVYHKSKNIFLLLPYFLVNIAT
YASLAPMMLKTVFLGTLGKKAVFLVTPKQSERFTVGEILKYTWDSLLFAVVVGALSLVAC
GSILPVVFITVGCLSAPIIIALSNISLPQKEISAPEKSREFIRKSNVSRPALLLNHKAAI
DTHSQSMEG

Enzyme Prediction     

No EC number prediction in MGYG000003226_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	114	305	2e-24	0.8478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	7.29e-31	97	322	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.06e-29	107	463	67	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	6.88e-26	111	319	17	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	1.28e-19	111	276	13	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.52e-18	119	303	26	214	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL20008.1	3.56e-158	1	521	1	524
QDL19322.1	3.56e-158	1	521	1	524
QIN44161.1	3.56e-158	1	521	1	524
QIN44840.1	3.56e-158	1	521	1	524
QIN42784.1	3.56e-158	1	521	1	524

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SRT3	5.07e-18	94	361	218	500	Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=CSLC6 PE=1 SV=1
Q9ZQB9	1.90e-15	129	361	277	520	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
Q7PC69	1.42e-14	131	361	303	540	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
A5F1Q0	9.11e-13	113	344	154	402	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=opgH PE=3 SV=1
Q9KSG9	9.11e-13	113	344	154	402	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999243	0.000033	0.000703	0.000000	0.000000	0.000020

TMHMM  Annotations     

start	end
9	31
41	63
351	373
378	400
407	429
467	489