CAZyme Information: MGYG000003205_01507

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_01507
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		59833.79	8.494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 433; End: 2031 Strand: -

Full Sequence      

MKNRKIVLSVAMTVLAAALSFAETLEVKINPEKTYQTVDNFAAADAWSGNFVGQYFDEAQ
KGQIAKWLFSQKIGADGNPEGIGLSMWRINVGGGSLERDGADIMPFQRRAESFLTKDGKG
YDWGKCAGQQYFMRKAREYGCDKFLLFSNTPPVQWTRNGKGYAENTKDFSSNLKPDCYGK
FADFLADVARHFQDEGFNIAYISPINEPQWKWDINAQEGSPWHTSEIFKVFAELDRAMTE
RKLDNTKMLFGEAADIQAIYKAHKWKHFEANKNELERPNNLLKNFFDKNGKWYVGNLKHQ
PMMVGGHSYSTHKTNEIIKSRRLSLGAACEKYGVEYQQTEWCLLPHFNSKNHEGFTPDWK
SDNRADIQVALLLGKLVYADFVYAGATAWGYWKGMEIKGDHALTGVYPADGDIRKGGVVR
ANKLLWALGNYSLFVRPGYKRIELAGAENLDDFAGVAFKSPDGGRIVAVFVNSSFGVGET
SLLLPEAYANRVSKISAFRTDANMDMGNLYQKDAKHIVLAPRSITTVVLDFN

Enzyme Prediction     

No EC number prediction in MGYG000003205_01507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	26	528	5.9e-146	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.08e-101	27	392	4	353	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.18e-13	1	532	1	431	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84534.1	2.30e-124	24	532	22	531
ADY36080.1	8.13e-120	27	528	45	537
QUT89021.1	1.51e-118	27	528	42	531
ALJ59966.1	8.50e-118	27	528	42	531
QNT66374.1	5.10e-117	1	531	1	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	4.91e-76	29	532	10	499	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	9.53e-14	13	502	9	422	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	1.87e-08	34	529	19	454	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7O0E_A	7.18e-08	34	529	12	447	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	7.68e-08	34	529	36	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000346	0.998838	0.000206	0.000214	0.000205	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003205_01507.