CAZyme Information: MGYG000003205_01414

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_01414
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		75967.43	6.451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 12898; End: 14937 Strand: -

Full Sequence      

MKKITAILMGLASLFAAQSWAESFAVKSPNGKLEAVVNDGDKLTLSVKADGKTIFDAFNI
GMKTDKGDLGKNAKALGSATMSVDAEIPTVYGIRSSVKDKYNQIEVEFGKYKLVVRAYDE
AVAYRFVTAFGGELTVVDETLELPLKSDDKIIAHAVNGVQDSFERFFLRQTVADMAKHHS
YSLPFLSIKNGHTVAVVESDVLDYPGMRFAYSGAKAKALFSKAPKTFKQKNKFTRTVDQS
HDYIAKTKGSRAFPWRGFIVAEKDIQLADNDTVYKLAEASRLADTSWIKPGTCAWEWWSD
CQLEGAGFIGGVNEQTYRYYIDFAASNNIPYVLLDAGWLTGVDVGGMDEKIDEAMISGKP
SIDVPAIIKYAHSKDVKILLWCLGQSMDKYGERAFEIMSSWGADGVKIDFIDRDDQQAQN
FYERMASIAAKHKMVVDFHGCAKPAGLQRTYPNVVNFEAVRGCEFNKFSEGLEPSHNIDL
VFTRMLQGPMDYTPGALRNVGKKDFQKSYSFPQAKGTRSHMVAQYILFYGPVQMLCDSAS
EYKKYPDILNFIAHAPTSWDDSKALEGKIGEYVVVARRKGDAWYIGGMNDWNERTVEIDL
SKILPEDSDFKAEIIRDSKNSNRLARDYKREVKEVTSESKLKIEMKKGGGFAIKITPKRI
PIIDDIVKFFTDEDDESED

Enzyme Prediction     

No EC number prediction in MGYG000003205_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	15	655	4e-180	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.57e-110	284	556	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	1.86e-44	559	656	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam14508	GH97_N	1.73e-43	28	278	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47767.1	1.73e-165	4	655	7	660
CBK64059.1	5.38e-165	1	658	1	665
BBE20321.1	8.09e-165	20	652	26	650
QSW91641.1	5.20e-161	20	659	19	660
QNR85654.1	2.40e-159	21	659	21	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.15e-146	28	655	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.96e-145	28	655	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	5.30e-65	26	654	3	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	7.33e-65	26	654	3	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.94e-64	26	654	3	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	2.42e-148	1	655	1	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	2.08e-56	25	600	42	574	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	2.91e-42	254	655	287	723	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999010	0.000192	0.000189	0.000184	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003205_01414.