CAZyme Information: MGYG000003205_00074

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_00074
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000003205_2|CGC1	72878.92	8.8436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 46021; End: 47961 Strand: +

Full Sequence      

MKIFKRLIVFVSVFSFLAIALICAENGISETPQNPYGICAHIAKNEYPVYRKAIDTMEAV
GIGTFRSGANWINAEKTKGKFDFSRWESLISYAEKKGIEPLVIFPSNTPSFAKPFPKHID
ELAEVCKRFAGHFKDKMKYFEVVNEPNLKIFWDGEDPDARAYANLLKRVSTAIKEGNPRA
KVLYSGVAGTPVEFIEESFKAGAGEYFDIMNFHPYSWYDIPEKTLLANIEKVKGLMHKYG
IEDKPVWITEFGYTSAQAHPSIPKYVAKSLKILGVDKAKGKIAYIHDERFAYFGNLFNGS
AEWLFPQAKNFHRINFDEIKNLSPSDCPVLYILPNEIFPKKYRSDLLEYVKKGGTLVTVG
GIPFYYDTEGLENGKAKRKVAGRSPLKAFRMGVKTFKDYGFVEPNLVKMRIHPGRRVAKT
ESAEGFSDIKCEGYFPPYFISTENTTPDDEVIPIVYGVFGDKKLPLGAIYKLGGEFKGNI
IAFYGILGESASEQMQAKMLPRQFILARSRGIERVFKYCLISDAFDYTRESHFGIVGKNL
EPKPSYYAYKTLAETLENSLPEYRSCGNINIAEWVREKDGVPVAAIWSNYYKQPVNIKFE
GKIISAKNYIGEKVGIAAEGQTLSLDADMGVLYLEGVKNVEICKSE

Enzyme Prediction     

No EC number prediction in MGYG000003205_00074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	74	258	4e-28	0.505800464037123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	3.30e-07	116	273	121	295	Glycosyl hydrolases family 39.
cd21510	agarase_cat	1.02e-04	114	255	71	234	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
pfam11790	Glyco_hydro_cc	1.95e-04	144	255	71	173	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
smart00633	Glyco_10	0.002	71	160	3	96	Glycosyl hydrolase family 10.
COG3693	XynA	0.002	71	146	69	151	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	2.46e-102	34	640	27	614
QDU57372.1	1.54e-68	27	638	21	626
AVM44901.1	1.29e-43	34	618	25	608
AHF90941.1	3.01e-30	24	588	212	803
ACZ43011.1	3.94e-27	34	255	302	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PX8_A	5.12e-06	116	251	124	278	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.018126	0.249359	0.731936	0.000207	0.000164	0.000197

TMHMM  Annotations     

start	end
7	29