CAZyme Information: MGYG000003203_02523

Basic Information

• Species: Butyricimonas sp900759925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp900759925
• CAZyme ID: MGYG000003203_02523
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000003203_319|CGC1	35609.17	7.9303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003203	5334161	MAG	United States	North America

• Gene Location: Start: 8094; End: 9020 Strand: -

Full Sequence      

MQKNIIITLLAILVLLNSAAIGYYIYEREVEHDEGEEYIPHFLLPSDVFCPDTFYLAGER
VPLERTDIIESFKKELIVNMNLHSHTIQVIKNSPRYFHIIEPILKEEKIPNDFKYLAVIE
SSLNPIAVSPAGAAGIWQLMSGTAKELGLEVDKDVDERYHIEKATRAACAYLKKAYDKFG
SWTSAAASYNGGMNMLTRQMDRQKEKKFYDLLMGEETGRYVYRMMALKQIMENPHLYNFH
VGIKYPIEETTQIKVTKSIKDLADFAQEHGITYKTLKRFNPWLRQTSLKVGKNKTYYIAI
PKDKEAYK

Enzyme Prediction     

No EC number prediction in MGYG000003203_02523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	96	237	8.8e-24	0.9481481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	8.17e-62	104	229	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.74e-27	99	211	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	2.67e-24	82	304	94	314	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	4.81e-20	116	226	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.62e-14	115	237	157	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51442.1	5.79e-174	1	308	1	308
AZS32129.1	1.93e-172	1	308	1	308
ADY32428.1	5.88e-118	46	308	49	311
SNV32652.1	5.88e-118	46	308	49	311
AHW59007.1	1.42e-99	48	301	46	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.62e-22	60	302	68	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.62e-22	60	302	68	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	5.09e-08	96	206	25	136	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	1.90e-06	120	198	85	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.680294	0.309651	0.006265	0.001077	0.000584	0.002128

TMHMM  Annotations     

start	end
5	27