CAZyme Information: MGYG000003189_01140

Basic Information

• Species: Haemophilus_D parainfluenzae_M
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_M
• CAZyme ID: MGYG000003189_01140
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666		71917.69	8.0951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003189	2132219	MAG	United States	North America

• Gene Location: Start: 22570; End: 24570 Strand: +

Full Sequence      

MKLNHALKASYIAISCAILSSTMPVSASNSNPFGFNKADSILSDMVFYQIGGGVGYMAPP
SRGTIPAAEFGIGWKANLMCGNFDIKTSIKNQLNGLTEGFKDLYSNVIESATGAVASLPA
MVIQRANPQLYDILTNGLYQGKIDFNSLKTSCEEMSKKLADATLNGRWSQSSDMESFKDI
TSTEPDATRAKKRLEESQGKEGKEWVGGKKRGGQGQEPIKIVEDVAKAGYNMQNKRNVLE
SGRISGSSCSGLLCQTWDNPKDMTDWLTNVIGEKQLTTCKTDCGTASSSRAGVGLTPEIE
KENIKTVTQLQKALNMSTPSVEVLAELSSTTVPVTRGLIESLREDPDAQVLGQRLASEIA
VAKTMEKMLLARRAVLTGMREPNVANNKDAQEELEKILTLIDREIGQIRMEIDLQKSLTG
NSAVAILQNKELREYNTGTGNVTRDSVDKRISDLANGTNSNAAELADADNINIPRNNVTL
EVPQMSNSLSYTGTGGTSGNSRGNTSYSSVPAIKGTALDQATGLLKKFEGFSDKAYWDVN
AYRTGYGSDTITKADGTIVKVTKDTVVSRADAERDLARRTQEFANRARNNVSSSTWDKLP
PNAQAALTSYAYNYGSLTKDVIAAAQASAQSGDMNALANAVRNRQNNNNGVNAKRRNQEA
DYILGK

Enzyme Prediction     

No EC number prediction in MGYG000003189_01140.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03755	conj_TIGR03755	0.0	43	457	1	418	integrating conjugative element protein, PFL_4711 family. Members of this protein family are found in genomic regions associated with conjugative transfer and integrated TOL-like plasmids. The specific function is unknown. [Mobile and extrachromosomal element functions, Plasmid functions]
cd00737	lyz_endolysin_autolysin	3.23e-12	524	616	4	86	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	3.92e-07	516	615	6	96	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	6.38e-07	515	615	2	91	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00735	T4-like_lys	2.28e-04	524	615	5	93	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE07600.1	8.58e-223	3	529	1	540
AAP95805.1	8.58e-223	3	529	1	540
ANF70987.1	1.37e-221	31	529	2	509
ANF74266.1	1.37e-221	31	529	2	509
ANF74701.1	1.37e-221	31	529	2	509

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000351	0.998812	0.000292	0.000191	0.000189	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003189_01140.