CAZyme Information: MGYG000003178_01728

Basic Information

• Species: Klebsiella quasivariicola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella quasivariicola
• CAZyme ID: MGYG000003178_01728
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	MGYG000003178_287|CGC1	45800.41	9.7208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003178	3011876	MAG	United States	North America

• Gene Location: Start: 18; End: 1253 Strand: +

Full Sequence      

MCIRDRCSFWGATQAQSRGGKILGYVLLGVACGMGVMTKGFLALAVPVVGVLPWVIARKR
WREVLTYGWLAVVVCTLVVLPWGLAIAQREPDFWRYFFWVEHIQRFAEKDAQHKAPFWYY
IPFLIAGSLPWLALLPGALKRGWRERDEARGALYLLGWVAMPFLFFSIAKGKLPTYILPC
FAPLSILMARYALEAAKTGAKALRINGMINLGFGLLGLIAVLVVSPWGVMHKPVWSKIEL
YKCLLAAIAFAVWALMGWLAMKDAGRRWSLAALCPLGLALLVGFAIPDRVIDSKQPQFLV
DIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAG
FADWLAAHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ

Enzyme Prediction     

No EC number prediction in MGYG000003178_01728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	379	2e-95	0.6962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	7	410	148	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.51e-60	7	384	146	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	4.49e-12	7	97	150	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV18040.1	2.09e-285	7	411	147	551
QBL47305.1	2.09e-285	7	411	147	551
VEB68241.1	2.43e-284	7	411	147	551
QQM82668.1	2.43e-284	7	411	147	551
QPV82277.1	2.43e-284	7	411	147	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.77e-14	12	286	183	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5XTL1	4.21e-279	7	411	147	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
A6TF96	5.97e-279	7	411	147	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1
B7N5M2	2.27e-173	3	411	143	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1
B7LAS2	3.22e-173	3	411	143	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=arnT PE=3 SV=1
B1LLL1	3.22e-173	3	411	143	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	37
41	58
65	87
117	139
152	169
173	195
207	229
244	261
268	287