CAZyme Information: MGYG000003172_00134

Basic Information

• Species: CAG-485 sp900555915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900555915
• CAZyme ID: MGYG000003172_00134
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000003172_12|CGC1	82586.01	5.1045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003172	1933519	MAG	United States	North America

• Gene Location: Start: 6394; End: 8622 Strand: +

Full Sequence      

MKSSILTAALLAATLQAMPTWAGIQPEVTWENLGHRPGGNGEAECLERFTIKNHGEGFTR
LAFCMPKHGMRALNPHDTIIELLPGYYAVESPRFATPSDSVTIDIAVEGWIHNAYEIPDG
MHLVADRKSIPTHNRWLPATSRRGQWIPDGWSNDPMVYGETAYAINDSLRSALRPGPYMQ
IPTLKAVKTTGRMTRMPALTLKMVDDPRERYYRVTIAGDTAVVSTNSSAPMAILAEVERR
MRESADGAGMMPEAELEDWADYGYRGLMIDVARNFTPKEEIMRILSLMARYGLNVLHFHL
GDDEGWRLETAGLPELTEVGSRRGYTETDDTGFLKQIYRGDGNPDSATTANGFYTEDDYI
DILRHAKALGIDVIPEFDSPGHSRAAIRAMEHRHRTSGDASLRLIHDGDTSRYSTAQFFG
DNLMNPALEGPYRLWGMVMDGIIDLHRRAGVPLRAIHIGGDEVPAHAWDGSAAAQDLMRS
EGMTNQRELYAHFVERLADLAAERGIKIAGWQEIALDHSKDYDRRVLPVTEAVNCWTNAG
TQGSRMATSGYPVVMSNVDYLYLDQTPTTHPEEPGFTWGGIVDEFRPLHATAELLCPGDS
AERANVVGISGHLFAETVRDTGMIERYLLPRLLGIAERGHNSQPTLSDEEYFGALTEEMG
RWATEGLEFYVRQPGIRLNGDMVEMNEPYGFGEIRYTLDGSEPTAESMLYEGPFRRGQAT
DIRARLFIGPSRSVTSILRAAR

Enzyme Prediction     

No EC number prediction in MGYG000003172_00134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	258	641	1.8e-89	0.9673590504451038

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	3.29e-140	258	644	1	419	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	2.84e-98	262	652	1	353	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.29e-93	262	639	1	342	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.27e-81	209	735	205	715	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd02742	GH20_hexosaminidase	2.15e-55	264	639	1	301	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10820.1	0.0	28	738	27	745
AHF12728.1	1.04e-125	2	736	5	829
CDL66413.1	4.41e-118	249	737	36	558
VTZ55501.1	2.31e-111	209	738	243	816
QUT80345.1	2.45e-111	211	739	260	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	4.68e-63	245	702	294	823	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	8.74e-63	245	702	294	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	1.47e-62	262	677	263	643	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
1C7S_A	4.16e-62	245	702	294	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZT_A	1.81e-61	262	677	260	640	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49007	4.56e-67	187	638	251	724	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P13670	3.77e-63	212	700	283	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	2.21e-61	245	702	321	850	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
Q04786	2.76e-61	247	639	300	716	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P96155	8.36e-59	250	639	248	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999125	0.000149	0.000178	0.000156	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003172_00134.