CAZyme Information: MGYG000003170_00158

Basic Information

• Species: Sutterella sp900764215
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900764215
• CAZyme ID: MGYG000003170_00158
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000003170_3|CGC1	30811.74	6.3972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003170	2004551	MAG	United States	North America

• Gene Location: Start: 5871; End: 6734 Strand: -

Full Sequence      

MAASALAAMLGAAAFWPDSDFASTAPSLSRVQEDLDVRAAFKPSDEALSGMAPSLALLEG
TAKMQEAPEETHEALTVEYDAVHEGSPRHLVAEYISRTFRIPMREARQITDWAVEIGEAR
DLDPLLILAVIGTESSFKPTARSHAGAEGLMQVMTSVHEAKFDAFGGREAAFDPYANMVV
GTDILSYLIQRTGSVRRALKWYSGAANLENDRGYGARVMREHGLLAVAAEGRTDAAVKLH
RAGKAAKSDAGNAARLGFARWVKLSERQGDAVRARNAGLQGEARKAS

Enzyme Prediction     

No EC number prediction in MGYG000003170_00158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	120	220	1.7e-18	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.57e-18	124	221	1	98	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	3.28e-18	101	220	2	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.29e-15	102	220	3	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	6.05e-14	115	214	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	1.57e-12	118	188	8	82	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55116.1	3.37e-56	31	287	51	309
BBF22549.1	3.72e-56	91	244	74	227
QQS89286.1	7.27e-55	52	273	55	273
QTD43912.1	6.98e-38	91	233	100	242
ACY33985.1	5.63e-37	61	222	74	239

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	1.69e-08	112	225	7	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	3.57e-07	121	203	1434	1512	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.57e-07	121	203	1434	1512	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
C5BCE9	1.59e-06	104	221	186	322	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
A7MLX9	6.80e-06	122	188	206	278	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003170_00158.