CAZyme Information: MGYG000003145_00820

Basic Information

• Species: UMGS822 sp900545825
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; UMGS822; UMGS822 sp900545825
• CAZyme ID: MGYG000003145_00820
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	MGYG000003145_6|CGC1	79704.23	4.6797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003145	2320952	MAG	United States	North America

• Gene Location: Start: 9513; End: 11753 Strand: +

Full Sequence      

MTTLPLDQAAHLTSGTLVFRFRVLADATLLSAAGERGQIALVSERDRLSVRVESPERSAF
IELEDAVPVTDGEWHAFALTVDDTATRVFVDGGLEMTSTATVFLGTIGASAIEIADDTVA
TITDLAVHADVWSPREVMAAASLPEPVAEFGANYLAAEDARALAGLTSGTTALRFRTRGV
GQAGTILAAGCGDEDAIRVSVTADSLIYAAKVAGAWRQWTASGQWACGDWHDVAIRCGAG
VTDIYVDGSRALHAPGFAFFGAAGAIERAVIGQDLRGDRLFGEVQTAAIYAQRLTEGGIL
KAAHRVSDDVIPVFDRGMEGAVSYRIPSLIALPSGRLVAGADQRIVIPNDAPNEIHFVVR
TSDDGGDTWSDMRTVAAFPGGGRDGASLIDSCLVYDAQRGRLDVIIDHFPGGIGQFNSVP
GTGFATDGRMELRDAQGRTHLWDRATGVVEADGEPTPYRVEADGSVTYDGQPCGRIFDKA
TGQTPGLTMVPTSYLMHFYSDDEGDTWSTPRHLNPALKLDWMTFLGTGPGIGCQLTRGAH
AGRLVAPYYASEATGKFFSAGVLYSDDGGETWLRGATAIERDGSGVERLEHLADKELSTY
EATVVECSDGRLLILMRNQHPSGRVACAYSADGGQTWGETHYHEDLPEIFSQPNAIRLPL
ADGSQALAFANATQLLPFRGEGVLRVSCDDGRTWPGRKTIKSGHYVYQCMAPLRDGTIAI
LWENEWQGLYLSRVSVPATGLVARGR

Enzyme Prediction     

No EC number prediction in MGYG000003145_00820.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	313	725	1.4e-84	0.9298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.41e-83	312	730	2	330	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.99e-20	492	720	79	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	6.97e-17	324	673	275	645	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd00110	LamG	4.26e-05	13	99	20	107	Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules.
smart00282	LamG	3.25e-04	16	100	1	87	Laminin G domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ65718.1	4.67e-224	14	740	11	772
ACR18588.1	2.60e-223	14	740	11	782
QRP10095.1	2.60e-223	14	740	11	782
QRP14191.1	4.18e-222	14	740	11	782
BDA65121.1	6.76e-209	6	741	11	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	2.60e-62	306	724	6	431	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	1.37e-61	306	724	5	430	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	1.48e-61	306	724	5	430	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
2W20_A	3.86e-48	319	728	21	453	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	4.35e-48	319	728	25	457	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	2.54e-59	306	725	377	811	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62575	3.80e-45	319	728	341	773	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	3.80e-45	319	728	341	773	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
Q27701	1.69e-31	252	724	216	730	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	5.41e-28	317	723	60	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003145_00820.