CAZyme Information: MGYG000003136_01367

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000003136_01367
• CAZy Family: GH101
• CAZyme Description: Endo-alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1425		157783.02	5.4077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003136	1781350	MAG	United States	North America

• Gene Location: Start: 1336; End: 5613 Strand: -

Full Sequence      

MTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSINFLGNSLVSVSSDQAGAKF
DGATMSNNTHVSGDDHIEVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQNSYGGGSNDWT
RLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITEDANADKKVDWQ
DGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKKINLHTDGLGQGV
LLKGYGSEGHDSGHLNYADIGKRIGGVEDFKALIEKAKKYGAHLGIHVNASETYPESKYF
NENILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEELKNKLGEGLDFIYVDVWG
NGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFQHWAADLTYGGYTNKGINSV
ITRFIRNHQKDSWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRSDYNGYVTNLFAHDVMT
KYFQHFTVSKWENGTPVTMSDNGSTYKWTPEMRVELVDADNNKVVVTRKSNDINSPQYRE
RTVTLNGRVIQDGSAYLTPWNWDANGKKLPTDKEKMYYFNTQAGATTWTLPSDWANSKVY
LYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTNPEMSWSEGMHIYDQGFNSG
TLKHWTISGDASKAEIVKSQGANEMLRIQGNKSTVSLTQKLTGLKPNTKYAVYVGVDNRS
NAKASITVNTGEKEVTSYTNKSLALNYVKAYAHNTRRDNATVDDTSYFQNMYAFFTTGSD
VSNVTLTLSREAGDEATYFDEIRTFENNSSMYGDNHDTAKGTFKQDFENVAQGIFPFVIG
GIEGVEDNRTHLSEKHDPYTQRDWNGKKVDDVIEGNWSLKTNGLVSRRNLVYQTIPQNFR
FEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRGNQASNLEMHELPNTWTDSKKAKKV
TFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANFRGYNDFIMDKLQIEEITLTGKMLTE
NALKNYLPTVAMTNYTKESMDALKEAVFNLSQADDDISVEEARAEIAKIDALKNALVQKK
TALVAEDFESLNAPAQAGEDLANAFDGNLSSLWHTSWSGGDVGKPATMVLKEATEITGFR
YVPRGSGSNGNLRDVKLVVTDESGKEHTFTVTDWPNNNKPKDIDFGKTIKAKKIVLTGTK
SYGDGGDKYQAAAELIFSRPQVAETALDLSGYETALAKAQKLTSKEHQEEVASVVASMKY
ATDNHLLTERMVAYFAEYLNQLQDQTTKPDAPTSSKGEEAAPILEVPEYKGPLGTAGEEE
APTLATQPEFNGGVNAVEALVNEKPAYTGLLATAGDQAAPTIEKPEYQISQLGQGKLAES
KTSVSTEDKKRLPETGESQSDTAIFLAGVSLALSAAVLATKRKEN

Enzyme Prediction     

No EC number prediction in MGYG000003136_01367.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	1	637	0	0.8967468175388967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	7.28e-161	180	470	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	4.83e-130	193	493	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam17974	GalBD_like	7.70e-104	800	997	1	190	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.
pfam18080	Gal_mutarotas_3	3.42e-79	1	179	75	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	2.40e-41	476	610	1	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ35090.1	0.0	1	1425	683	2176
QKL33722.1	0.0	1	1425	677	2204
AYF95093.1	0.0	1	1425	677	2187
VEF78371.1	0.0	1	1425	672	2141
QLL96372.1	0.0	1	1425	672	2121

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A58_A	0.0	1	1019	93	1111	Thestructure of GH101 D764N mutant from Streptococcus pneumoniae TIGR4 in complex with serinyl T-antigen [Streptococcus pneumoniae TIGR4]
5A56_A	0.0	1	1019	93	1111	Thestructure of GH101 from Streptococcus pneumoniae TIGR4 in complex with 1-O-methyl-T-antigen [Streptococcus pneumoniae TIGR4]
5A57_A	0.0	1	1021	93	1113	Thestructure of GH101 from Streptococcus pneumoniae TIGR4 in complex with PUGT [Streptococcus pneumoniae TIGR4]
2ZXQ_A	0.0	1	1215	105	1369	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]
5A59_A	0.0	1	1019	93	1111	Thestructure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with T-antigen [Streptococcus pneumoniae TIGR4],5A5A_A The structure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with PNP-T-antigen [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2MGH6	0.0	1	1424	408	1767	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	0.0	1	1424	408	1767	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
A9WNA0	8.47e-112	32	1011	145	1037	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
P29767	1.97e-09	1095	1215	63	181	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003136_01367.