CAZyme Information: MGYG000003134_01650

Basic Information

• Species: Streptococcus mitis_BB
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mitis_BB
• CAZyme ID: MGYG000003134_01650
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		22901.04	9.0006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003134	1850168	MAG	United States	North America

• Gene Location: Start: 12301; End: 12915 Strand: +

Full Sequence      

MFKRIRRVLVLAVFLFAGYKAYRVHQDVKQVMTYQPMVREILSERDTPANEELVLAMIYT
ETKGKEGDVMQSSESASGATNTINDNASSIRQGVQTLTDNLYLAQKKGVDVWTAVQAYNF
GPAYIDFIAQNGKENTLALAKQYSRDTVAPLLGNTTGKTYSYIHPISVFHGAELYVNGGN
YYYSRQVQLNLYIIKCFTLFSTSG

Enzyme Prediction     

No EC number prediction in MGYG000003134_01650.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.06e-85	28	191	1	165	Lysozyme-like.
cd16891	CwlT-like	4.60e-67	34	191	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	3.98e-11	1	202	93	291	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ11785.1	6.70e-142	1	204	1	204
QGS42313.1	6.70e-142	1	204	1	204
ALD68078.1	7.82e-141	1	204	1	204
AEL10464.1	1.11e-140	1	204	1	204
QBZ13537.1	6.43e-140	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	7.50e-17	30	187	23	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.40e-15	30	187	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	7.14e-138	1	204	1	204	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	1.44e-137	1	204	1	204	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
P0DC90	3.51e-72	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	3.51e-72	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	4.98e-72	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.860479	0.065183	0.073086	0.000311	0.000178	0.000778

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003134_01650.