CAZyme Information: MGYG000003125_00144

Basic Information

• Species: Corynebacterium kefirresidentii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium kefirresidentii
• CAZyme ID: MGYG000003125_00144
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000003125_2|CGC2	43393.89	8.4818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003125	2294743	MAG	United States	North America

• Gene Location: Start: 31359; End: 32540 Strand: +

Full Sequence      

MKKSVWFTAFPLCLSALVALWWLIDIPELFSGHFSTYYHIDLDVYREGGAGFGSDLYAKD
YLVGSNRDVSLPFTYPPFAALLFVPLSWIPLTAASILISIASFAALWGCVALVLRALRCP
GWAGWALLAAMLTEPITETFSFGQVNILLTALVVVDILWLSPSRGRGVLTGIAMAIKLTP
AVFLAVFFVRREWRAFFSALGAFLAAGLLAFACNSHSSIQYWSDTLRDSNRIGGLAYSSN
QSLRGFFSRLAPEHAEKLWLVAVLLVIALVWFTMERLSQENQAVLMLLAASVSLLCSPVS
WSHHFTWLVLAGVLLVARRHWGLAALTWLALLARGHWLVPHANGQELSWAWWQHIVGNDY
AIVTALLVLCSLPLALRRAGAYQSAVEPASTQR

Enzyme Prediction     

No EC number prediction in MGYG000003125_00144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	73	298	4.9e-70	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	5.98e-44	40	391	45	409	mannosyltransferase; Provisional
pfam09594	GT87	2.83e-37	73	298	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN48578.1	6.94e-282	1	392	1	392
QQU82094.1	1.35e-263	1	392	1	392
QQA98319.1	1.91e-263	1	392	1	392
QRQ66188.1	3.86e-263	1	392	1	392
VEH73286.1	5.04e-211	2	392	6	394

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	9.07e-51	32	377	39	409	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	9.07e-51	32	377	39	409	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	7.13e-47	38	360	45	400	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WN00	7.00e-31	40	364	69	408	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	7.00e-31	40	364	69	408	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.981952	0.016543	0.001181	0.000038	0.000033	0.000257

TMHMM  Annotations     

start	end
5	24
69	91
96	118
138	160
167	189
193	215
258	275
285	307
320	339
354	376