CAZyme Information: MGYG000003113_00992

Basic Information

• Species: Pauljensenia sp001838165
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp001838165
• CAZyme ID: MGYG000003113_00992
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000003113_7|CGC1	75656.25	4.6928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003113	2324284	MAG	United States	North America

• Gene Location: Start: 25351; End: 27582 Strand: +

Full Sequence      

MKCGTRSLAVLGALALSAMGLVPAAWAADMSQSGEEHPGLVDTPIPDIQAVGDGDDSAMV
GATVTTLGVVTAAYPAGESGMGETLDGYTIQTPGSGGAWEPGRTRSDGLFVYAGNKGEIP
APGTCVRVTGTVGEFPATSAKGNPQSLTQLAATSVSEVEGCQAPTPVPATRVPTPEEAEA
LESMLLAPQGTWTITDNYQTNQYGTLTLTPGESPLRSATDVVAPGQAAREYEAANAARAI
ALDDGTNTNLQKGTATEAAYAYLANGSPARVGYHVAFTKPVVLEPRHGSFVFQPASMVAG
HPDRSPVTITGERPSAPTVGGDTRVATFNVLNYFSDLGVDEAGCKGYPDRAGAFVTAKKC
KVRGAFSREAFANQEAKIVSAINALDADVVALEEIENPVAVGAGTDRDASLARLVEALNK
DAGAGTWAYVPSPGSVPEAEDVIRVAFIYKPATVAPVGPSLIHDDPAFTGLARQPLAQEF
ARVTTERSAPATFVVVANHFKSKGSVPEGAPAGNVDSGDGQGNANAIRVAQAASLASFAA
RFADKPTLLVGDFNSYSQEDPIKALEAAGWERVSGAGEASYVYAGRSGSLDHVFANAAAK
PLLAGVTSWAVNAQESIAFEYSRAGMNAHLAVEADNPYRSSDHNPELIGLTLLGGDAPAP
TPSTDPSSAPTAAPSPADPSASPAPAPSRTATASSRKAPTRAGTASGLARTGADAGPAIG
IGILLAAIGGGLILASRRLRSRG

Enzyme Prediction     

No EC number prediction in MGYG000003113_00992.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033681	ExeM_NucH_DNase	0.0	68	652	3	545	ExeM/NucH family extracellular endonuclease.
COG2374	COG2374	1.27e-112	40	662	194	798	Predicted extracellular nuclease [General function prediction only].
cd10283	MnuA_DNase1-like	6.66e-48	324	650	2	266	Mycoplasma pulmonis MnuA nuclease-like. This subfamily includes Mycoplasma pulmonis MnuA, a membrane-associated nuclease related to Deoxyribonuclease 1 (DNase1 or DNase I, EC 3.1.21.1). The in vivo role of MnuA is as yet undetermined. This subfamily belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.
NF033680	exonuc_ExeM-GG	1.06e-45	43	670	198	858	extracellular exonuclease ExeM. ExeM, as described in Shewanella oneidensis, is a biofilm formation-associated exonuclease that cleaves extracellular DNA (eDNA), a biofilm component. Members of the ExeM family contain two or three pairs of Cys residues, presumed to form disulfide bonds, and a C-terminal GlyGly-CTERM membrane-anchoring segment. Strangely, engineered removal of the GlyGly-CTERM region did not result in net export from the cell and appearance of the enzyme in culture supernatants.
cd04486	YhcR_OBF_like	3.88e-12	65	158	1	74	YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC31565.1	9.80e-126	44	658	240	844
SDS92078.1	2.36e-119	52	652	246	829
QAY73698.1	1.25e-116	52	649	305	897
ACZ32093.1	9.72e-115	37	651	224	829
QAY64865.1	2.13e-111	49	662	250	855

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000540	0.998363	0.000256	0.000322	0.000265	0.000222

TMHMM  Annotations     

start	end
7	29
713	735