CAZyme Information: MGYG000003097_01658

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_01658
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000003097_15|CGC1	72291	5.1057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 49251; End: 51173 Strand: +

Full Sequence      

MKKYTVKAFMLWGVIAGISACTTLSRQDASQGKDRYDFGNILNIAITPDSTVRRVGCFTD
AGSWMGFTIPQRDKWINGFCGPFSIDNRIWFAQSAVEASITGATTTMVADSTSYFPGEVY
MSASSDAGTICQRLNFINASTALLQVESNSDKGLSFTARQWNNNVYLEADRNKVTARHAN
GEIITITFDSDVTLTCNGQNYIAKTAPGCKQTDIAISFFASEKELPASEQRIRALLNNPS
QDLKANAERWNGYLSKILRNDMKPEYDRIAVKSAVTLISNWRTHRGGLLHEGVIPSHAVS
YFIGFWAWDSWRFSAALASFAPELAKNNIRAMFDYQLPDGMIIDCIYTNSADNNTRDSKP
PLVCWAVDEIFTHTQDTTFVKEMYPQLLAYYKWWYNKRDHNHNGICEFGSTDGTLEAAAW
ESGMDNAIRFDNTKMLKNADDAWSMDQESVDLNAYLAYECKLLKKFATLIGTHFDGPDYS
DQIADYFFDDKIGWFCDRRLSDGGFIEEPGCEGYTPFWVQIADKKQMDKAIKLLTDTTKF
STYIPFPTAAADNPKCDPNGYWRGPIWLDQTYQAIKGLRNYGYGELADQYTEQVFERCQG
LTGDAPIHENYGTHNGERLQAPHFSWSSSHLLMMYEDYGK

Enzyme Prediction     

No EC number prediction in MGYG000003097_01658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	183	638	1.9e-114	0.5912280701754385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.09e-132	58	638	59	783	alpha-glucosidase; Provisional
COG3408	GDB1	2.22e-16	297	635	277	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	1.83e-09	377	636	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	1.10e-08	302	639	125	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	0.003	293	394	144	239	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	1	640	1	638
QJR62245.1	0.0	1	640	1	644
QJR74523.1	0.0	1	640	1	644
QJR66502.1	0.0	1	640	1	644
QJR61716.1	0.0	1	640	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.80e-80	53	638	27	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.46e-79	53	638	27	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.03e-79	53	638	27	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.49e-76	197	638	209	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	6.31e-39	53	411	353	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.35e-79	53	638	50	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	2.34e-17	306	632	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	5.50e-17	306	632	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
O43280	4.36e-06	290	639	160	551	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_01658.