CAZyme Information: MGYG000003095_00108

Basic Information

• Species: CAG-460 sp900546715
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-460; CAG-460 sp900546715
• CAZyme ID: MGYG000003095_00108
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		42455.12	5.1098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003095	1544654	MAG	Spain	Europe

• Gene Location: Start: 94510; End: 95595 Strand: -

Full Sequence      

MKDIKICVYAICKNESKFINRWLESIKDADYICVLDTGSTDNSVELLKNAGVIVETKTFT
NFRFDEARNESIKLIPEDTDVCVCIDIDEVMLPGWKDAIKKAWKSDTTRLRYIYNWNLDE
HNNPKVSFYQDKIHAYVGYKWVNPVHEILKYSGEEEHYVTTDELIINHYPDQTKSRSSYL
PLLELSVKEDPENDRNMHYLGREYMYYGKWNEAITTLKKHLSLRSATWKDERCASMRFIA
RSYLGLNDIDNAVYWYNEAIKEAPHLRDPLVELALVYYQLEDWQEVIKYCNTALNIPINA
KTYINEVFSFDETIDDLLSLVYYNTGNIDKAVKHATKALEINPENERIKNNLEIMRSKLQ
N

Enzyme Prediction     

No EC number prediction in MGYG000003095_00108.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.16e-16	5	170	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	5.71e-12	239	340	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	9.47e-11	270	361	4	84	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	5.47e-10	197	294	4	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR02917	PEP_TPR_lipo	9.38e-08	193	352	735	877	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58819.1	3.97e-131	1	360	1	361
QOX65321.1	8.91e-127	1	359	1	360
QAT50106.1	1.12e-125	1	358	1	359
AQS58818.1	8.60e-125	1	360	1	361
CAB1239995.1	1.07e-124	1	359	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000103	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003095_00108.