CAZyme Information: MGYG000003091_00596

Basic Information

• Species: Parabacteroides sp900547435
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900547435
• CAZyme ID: MGYG000003091_00596
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54553.8	4.9031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003091	3044653	MAG	Spain	Europe

• Gene Location: Start: 26174; End: 27622 Strand: +

Full Sequence      

MLPNKEAYNETCAAVGNVLFNYRMFLAEKDAKYVDVAEVALYNNVLAGVNLDGNRFFYVN
PLEVDGPQGFNQGVAGRSPWFGTACCPSNLARLVPQISGMMYAHTSDEIYCTLYAGNKTV
IPLESGNVDIEQITNYPFDETIRFHITPQQGEQTFALRLRIPTWAMNQFVPGDLYDYVDN
QSSEWHITLNGKKINVDLHKGFVTLYRTWKAGDEVVLQLPMPVRYTKAIPEVEADRNRLC
VTRGPLVYCAEAVDNPAIVSSYYITPSKDTQVRKEMTGKLKGIDFVEIPAQSVEEGQTQV
ERLTLIPYYAWDNRGDDAMIVWLSDSPDVAKASMPSLQENVKEVRASYTFSGDDVRAIAD
NKYPKNSADASIPRWTSWPEKGKKQWVELQLKKPTHIQSISVYWYDDKGGVQIPEAWEVE
YQEKGQWMRFPIYVTDSYQLNKDQFNMVHAGREITTEAIRLLITPKKGASAGILEVVVEE
GK

Enzyme Prediction     

No EC number prediction in MGYG000003091_00596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	2	249	2.7e-86	0.4389312977099237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	1.48e-75	2	323	284	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	6.83e-75	2	249	282	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD19473.1	6.75e-192	2	482	341	824
AIA99612.1	6.44e-174	2	476	351	824
QJE94520.1	6.76e-169	2	479	341	819
BBO34810.1	2.29e-165	2	478	341	824
QDV74096.1	1.48e-163	2	478	353	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	4.15e-88	2	323	307	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	4.22e-66	2	325	325	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.27e-63	2	325	325	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.54e-52	2	323	373	694	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.29e-44	2	314	330	647	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	7.08e-44	2	314	330	647	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003091_00596.