CAZyme Information: MGYG000003072_01192

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_01192
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003072_3|CGC4	35547.09	9.7294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 265775; End: 266737 Strand: -

Full Sequence      

MIKSKWFKTVGSLALVGILAASVAVGSVSAGLAKGSKFLGNIIANQVPSNFSPYWNQVTP
ENSTKWDAVEGTRNVMNWGQADMAYNYANNNGFPFKFHTLVWGNQQPNWINSLSAADQKA
EVTQWIKAAGQRYSKSAFVDVVNEPLHAKPSYRNAIGGDGATGWDWVIWSFQQARQAFPN
SKLLINEYGIIGDPAKADQYIQIINLLKNRGLVDGIGIQAHYFNMDNVSVNTMNTVLNKL
AATGLPIYVSELDMTGDDNTQLQRYQQKFPVLWKHSAVKGVTLWGYNQNQTWQAGSHLVN
SNGTERPAMQWLRNYLANNP

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	46	314	4.2e-78	0.9108910891089109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3693	XynA	6.69e-107	11	320	8	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	2.64e-91	36	314	19	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.98e-84	65	312	2	263	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN76982.1	4.54e-241	1	320	1	320
APO43007.1	8.80e-239	1	320	1	320
QOS81827.1	7.45e-231	1	320	1	320
QLG37741.1	5.19e-227	3	320	5	322
QKS57705.1	2.56e-222	1	320	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMY_A	3.64e-94	33	320	5	303	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylose [Xanthomonas citri pv. citri str. 306],4PMY_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylose [Xanthomonas citri pv. citri str. 306],4PMZ_A Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylobiose [Xanthomonas citri pv. citri str. 306],4PMZ_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylobiose [Xanthomonas citri pv. citri str. 306]
4PN2_A	3.88e-94	33	320	6	304	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylotriose [Xanthomonas citri pv. citri str. 306],4PN2_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylotriose [Xanthomonas citri pv. citri str. 306]
4PMX_A	4.01e-94	33	320	6	304	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri in the native form [Xanthomonas citri pv. citri str. 306]
1NQ6_A	1.03e-34	30	295	7	279	CrystalStructure of the catalytic domain of xylanase A from Streptomyces halstedii JM8 [Streptomyces halstedii]
1ISV_A	7.81e-32	27	316	4	300	Crystalstructure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylose [Streptomyces olivaceoviridis],1ISV_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylose [Streptomyces olivaceoviridis],1ISW_A Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylobiose [Streptomyces olivaceoviridis],1ISW_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylobiose [Streptomyces olivaceoviridis],1ISX_A Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylotriose [Streptomyces olivaceoviridis],1ISX_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with xylotriose [Streptomyces olivaceoviridis],1ISY_A Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with glucose [Streptomyces olivaceoviridis],1ISY_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with glucose [Streptomyces olivaceoviridis],1ISZ_A Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with galactose [Streptomyces olivaceoviridis],1ISZ_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with galactose [Streptomyces olivaceoviridis],1IT0_A Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with lactose [Streptomyces olivaceoviridis],1IT0_B Crystal structure of xylanase from Streptomyces olivaceoviridis E-86 complexed with lactose [Streptomyces olivaceoviridis],1V6U_A Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 2(2)-alpha-L-arabinofuranosyl-xylobiose [Streptomyces olivaceoviridis],1V6U_B Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 2(2)-alpha-L-arabinofuranosyl-xylobiose [Streptomyces olivaceoviridis],1V6V_A Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(2)-alpha-L-arabinofuranosyl-xylotriose [Streptomyces olivaceoviridis],1V6V_B Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(2)-alpha-L-arabinofuranosyl-xylotriose [Streptomyces olivaceoviridis],1V6W_A Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 2(2)-4-O-methyl-alpha-D-glucuronosyl-xylobiose [Streptomyces olivaceoviridis],1V6W_B Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 2(2)-4-O-methyl-alpha-D-glucuronosyl-xylobiose [Streptomyces olivaceoviridis],1V6X_A Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(3)-4-O-methyl-alpha-D-glucuronosyl-xylotriose [Streptomyces olivaceoviridis],1V6X_B Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(3)-4-O-methyl-alpha-D-glucuronosyl-xylotriose [Streptomyces olivaceoviridis],1XYF_A Endo-1,4-Beta-Xylanase From Streptomyces Olivaceoviridis [Streptomyces olivaceoviridis],1XYF_B Endo-1,4-Beta-Xylanase From Streptomyces Olivaceoviridis [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23030	6.60e-70	37	316	323	597	Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynB PE=1 SV=2
O94163	5.17e-32	12	296	15	305	Endo-1,4-beta-xylanase F1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xynF1 PE=1 SV=1
Q4P902	1.93e-31	46	308	66	331	Endo-1,4-beta-xylanase UM03411 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_03411 PE=1 SV=1
C5J411	5.27e-31	33	316	37	327	Probable endo-1,4-beta-xylanase C OS=Aspergillus niger OX=5061 GN=xlnC PE=2 SV=2
A2QFV7	1.02e-30	33	316	37	327	Probable endo-1,4-beta-xylanase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xlnC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.596599	0.385536	0.009176	0.001606	0.000782	0.006308

TMHMM  Annotations     

start	end
13	32