CAZyme Information: MGYG000003069_00077

Basic Information

• Species: Bifidobacterium gallinarum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium gallinarum
• CAZyme ID: MGYG000003069_00077
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000003069_1|CGC2	81517.19	4.5796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003069	2149385	MAG	China	Asia

• Gene Location: Start: 102261; End: 104570 Strand: +

Full Sequence      

MTAQSIDALMSAMSFTEKVGQLNQRLLGWKALTRDGAGRLVVTDELKREIDRWGGLGVLY
GLFRADPWSGQHWGNGIRPEERPEAIRLVQEAVLTRSAHGIGVLLSEEAPHGHQALGGTI
LPTNLAMGATFDPEAVRQAQEAVAAELAASGVHIALVSGLDMARDPRWGRCEECFGEDPL
MASRMCEAIVTGMQGEDRSRVGRGGVAVVLKHLAAQGEAVGGRNGQSAIIGTHDLHEIHL
PPVVAGVKAGALGFMAAYNDIDSVPCCASPWLLQEYLRDELGFDGIVMADGLAVDRLVDM
AGSIPASGRAALLAGVDVSLWDQGFASLERYADDEAVVAAVDRSLRRVLELKAMFGLLPE
GCNAGADRVPSGSSERIAVGRGSVALPKAEAIAGAIARTRTESRTLAGECLTLLDGAEQW
DGIGACLRDDQSGPIIVTGPFADDMACFLGDYTAPLERTQITSVYRQLRERFGERVLLSA
DGTGLEGADWLNAAAVIAVLGGTSERSYDSAFADNGAAAAVAEHGATCGEGVDLCDVTLP
WGQDALLDRVRELTEAPVVSVVVSGRAHVLTHVLEVSDATLWAGYAGPYGPQSVVEALVG
DAGMPGRLPVTLPAYAGAVPVRYNDRQSAEHVYRDAEEPVLLPFGFGEGSLQGVSCEDLK
VTASGESLHLHLKLHTDGVTDPGTLNVFVRRVGGTRIPRLAQLVASVYVRDKSRGQWDVD
AEVPVAALMDEADRAMRIHLWVGTAIPSDECEVVLERGNADTVYVRQTV

Enzyme Prediction     

No EC number prediction in MGYG000003069_00077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	97	320	4.2e-60	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.81e-63	13	386	1	341	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	4.80e-61	6	647	38	645	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.63e-51	17	351	4	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.42e-25	119	647	112	630	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.06e-18	435	647	20	213	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY32596.1	0.0	1	769	1	769
BAQ31884.1	0.0	5	740	7	731
QOL47076.1	0.0	5	750	7	742
ADQ02914.1	0.0	5	750	7	742
CBK70292.1	0.0	5	750	7	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.07e-49	6	647	14	632	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.84e-49	6	647	14	632	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	2.23e-47	6	647	13	631	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	5.36e-47	79	711	101	713	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	2.67e-43	6	647	7	613	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.77e-48	86	647	89	645	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	6.15e-46	86	663	89	660	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.41e-40	4	647	38	635	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	2.13e-39	119	647	88	601	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.31e-36	56	647	81	656	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003069_00077.