CAZyme Information: MGYG000003068_00589

Basic Information

• Species: UMGS1388 sp900551345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; UMGS1388; UMGS1388; UMGS1388 sp900551345
• CAZyme ID: MGYG000003068_00589
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		26933.51	7.4813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003068	1753072	MAG	United States	North America

• Gene Location: Start: 310; End: 1041 Strand: -

Full Sequence      

MNLKKLILTNNDCYKAGKKITPKGIMIHSTGANNPNLKRYIAPDDGLLGVNINNNDWNRS
GTEACVHAFIGKLADGSIATYQTLPWDHRGWHAGGDANNTHISFEICEDGLTDKEYFNKV
YKEAVELCVYLCKKYGLTEKNIICHSEGYAKGIASNHGDVMHWFPKHGKSMDTFRADVKS
LLEGDNMSKFTDIKGHYAEKHIEKLEAYGIVNGDGNGKFNPDQQITRADAAIMIANALNV
LGK

Enzyme Prediction     

No EC number prediction in MGYG000003068_00589.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	1.17e-25	22	147	2	115	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	2.12e-17	21	151	1	116	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00644	Ami_2	6.58e-14	21	147	2	119	Ami_2 domain.
pfam00395	SLH	3.11e-11	190	230	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	2.60e-07	188	234	641	687	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM67796.1	3.22e-113	1	192	1	195
QAT44066.1	1.11e-109	1	192	1	195
AEY67694.1	3.77e-108	1	182	1	185
ABZ85376.1	8.75e-101	1	183	1	186
AOT72278.1	9.03e-101	1	182	1	188

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RMZ0	7.02e-06	176	237	72	138	Uncharacterized cell wall amidase pXO2-42/BXB0045/GBAA_pXO2_0045 OS=Bacillus anthracis OX=1392 GN=pXO2-42 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999854	0.000163	0.000018	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003068_00589.