CAZyme Information: MGYG000003064_01838

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_01838
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554	MGYG000003064_6|CGC5	63983.18	9.2678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 138734; End: 140398 Strand: +

Full Sequence      

MKPIMISDQIKHLALLLLVCFFSFFVHNDFIPADLMESRNLATAQEMVALDNYLAPTMNG
ELRLEKPPLPTWIAACVNHIKPHSLSAQRYAAGVAATLMVVFLYLVVRQLSKNSTVSFVC
ALILATCYNVIMMGRTATWDIYCHSFMLGAIFFFIKALSHEGTQWRSFVLTGLFMGLSFL
SKGPVSFFALLIPFIIAYLITWHPSFKGKMKPIIAMIVVCLMVSFWWPVYIYIFHRDWGV
HIANKESSSWLNHNVRPWYYYWQFPAEAGIWALFWVTSLVWPCWRKRFSQIHLHKIYLFS
ILWTVVSLILLSLIPEKKTRYLLPLLIPGAINVGLCLYYYLSGRLILSREKRLFRINMSL
ILLVILALPVALYLFFVQKQELEISLFAMICFCCFLLALLLAWSIYNRRVNYKIALGCVI
GTMLVVEGLCFIPAGKLFINNERHSISEVRKIPVLQHLPFYYVEGEELRIELVYESDRVI
RPLNIRNMNLVESKLPFVLVSATPADSVLDASKWEIDEIGRYDNNWQKTNSGKYNPDLVR
YVSVLRIKSTDSTP

Enzyme Prediction     

No EC number prediction in MGYG000003064_01838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	426	7.6e-65	0.774074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.35e-27	15	374	12	372	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.42e-16	66	228	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.80e-15	11	374	4	366	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1928	PMT1	9.18e-05	96	281	120	309	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.21e-04	97	237	94	242	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	2.50e-17	13	325	10	327
BCL61706.1	1.09e-16	37	381	32	379
VEH49522.1	2.51e-16	16	334	9	328
SQF86445.1	2.51e-16	16	334	9	328
CBX27700.1	3.43e-16	7	331	2	339

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCB9	3.16e-13	27	353	25	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q3KCC9	1.34e-12	27	357	43	365	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4KC80	2.26e-12	16	334	9	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q02R27	2.99e-12	16	367	9	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
A6V1N8	2.99e-12	16	334	9	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994973	0.003080	0.001022	0.000015	0.000011	0.000920

TMHMM  Annotations     

start	end
13	31
90	107
114	136
184	206
213	235
261	283
296	315
319	341
353	375
385	407
414	435