CAZyme Information: MGYG000003035_01267

Basic Information

• Species: CAG-485 sp900542185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900542185
• CAZyme ID: MGYG000003035_01267
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000003035_17|CGC2	43829.45	6.8072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003035	3548444	MAG	Netherlands	Europe

• Gene Location: Start: 42939; End: 44087 Strand: +

Full Sequence      

MNTRLSISLLILAATVAPLRAADIREASGIDGCPIKTIVEKCYPQNLYIGIATQHKLLDS
LSGEIADREFGYITPANDFKQSYIHPAPGKWQWKRSDEFLSHCSANGQMMRVHGPISPQC
SAWVRDDDRTNQELDAMLDEYFIALCRHIDRQPSVKWMDVVNETVCKNRINCKKYGTYEP
GDWFGPRQGDNLWENPWLALGYDSYKGNNFPTYIRRAFEISNKYAPNVKQIINQHGDFNA
VEWDKIKSLVEYLRSRGLRVDGLGWQAHINTGWEKTENRLRDLDSFITWCHANGLEFHIT
EMNVWINRGDTETDQAATFKAVFDTVIPHCAQGPTAICFWNVRDEDTDKAVRQGTLWRND
GTPRPAYFALRESLAKNALTRF

Enzyme Prediction     

No EC number prediction in MGYG000003035_01267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	43	372	3.1e-52	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	5.39e-45	48	372	11	310	Glycosyl hydrolase family 10.
COG3693	XynA	1.44e-36	51	378	39	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
smart00633	Glyco_10	1.89e-35	80	370	2	263	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT43884.1	5.52e-149	36	376	52	394
QUT22690.1	5.14e-134	34	374	37	380
QDU59060.1	4.25e-103	31	374	52	387
QHI69082.1	9.87e-103	31	374	22	357
QZT37897.1	1.94e-97	14	374	32	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VBR_A	2.56e-24	46	376	14	322	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
3NIY_A	3.11e-24	46	376	30	338	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
5AY7_A	3.75e-19	39	371	19	344	Apsychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5AY7_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5D4Y_A A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples],5D4Y_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples]
5Y3X_A	1.30e-18	35	370	29	354	Crystalstructure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_B Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_C Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_D Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_E Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_F Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL]
1E0W_A	1.97e-16	48	374	15	300	Xylanase10A from Sreptomyces lividans. native structure at 1.2 angstrom resolution [Streptomyces lividans],1E0X_A Xylanase 10a From Sreptomyces Lividans. Xylobiosyl-Enzyme Intermediate At 1.65 A [Streptomyces lividans],1E0X_B Xylanase 10a From Sreptomyces Lividans. Xylobiosyl-Enzyme Intermediate At 1.65 A [Streptomyces lividans],1OD8_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-isofagomine lactam [Streptomyces lividans],1V0K_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-deoxynojirimycin at pH 5.8 [Streptomyces lividans],1V0L_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-isofagomine at pH 5.8 [Streptomyces lividans],1V0M_A Xylanase Xyn10a from Streptomyces lividans in complex with xylobio-deoxynojirimycin at pH 7.5 [Streptomyces lividans],1V0N_A Xylanase Xyn10a from Streptomyces lividans in complex with xylobio-isofagomine at pH 7.5 [Streptomyces lividans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60041	8.00e-22	29	381	19	346	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
P40944	4.42e-21	35	370	353	675	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 GN=xynA PE=3 SV=1
P26514	3.85e-16	2	374	10	341	Endo-1,4-beta-xylanase A OS=Streptomyces lividans OX=1916 GN=xlnA PE=1 SV=2
P23556	7.91e-16	41	349	19	311	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q02290	1.08e-15	41	378	25	329	Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum OX=4758 GN=xynB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999137	0.000163	0.000152	0.000145	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003035_01267.