CAZyme Information: MGYG000003023_00931

Basic Information

• Species: Parasutterella sp900554375
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Parasutterella; Parasutterella sp900554375
• CAZyme ID: MGYG000003023_00931
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33519.4	7.871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003023	1826986	MAG	Netherlands	Europe

• Gene Location: Start: 4143; End: 5048 Strand: -

Full Sequence      

MRRAVQLRPAAYIGVDAPDFNLSIEEKVRSSGIPVIHMVAPAIWAWRPQRIHQIKRAVDH
LLLIFPFEEKIFKEAGIPSTYIGHPLAEIIPMEPDTDGARRKLNILAQGPVIAILPGSRK
DEIRWCAPAFFGAASLVLKQEPKTRFIVPAADEQRKKEILEVLSLFPDVKDNTVLLDGKS
HLAMEAADAILVASGTATLEAALYKKPLVVGYAMPALSAMLILSKGQTKWISLPNILAQK
TLIPECVQMFCSPEILSSHLLYALEPKRQEYLKEVFSEMHETLLRPTSQLATEAIDQVLK
H

Enzyme Prediction     

No EC number prediction in MGYG000003023_00931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	283	1.7e-91	0.7768361581920904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.40e-113	2	300	79	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.07e-98	2	300	79	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.66e-77	2	297	76	372	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.59e-73	2	283	83	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	6.95e-33	9	283	311	589	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU65980.1	3.09e-157	1	299	83	381
QQQ97139.1	3.09e-157	1	299	83	381
QDA54177.1	3.30e-102	9	297	97	387
QQS88891.1	4.76e-99	1	296	88	385
BBF22932.1	2.13e-95	1	295	89	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.16e-60	2	295	84	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.30e-60	2	295	84	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4JF62	6.95e-91	2	300	86	383	Lipid-A-disaccharide synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=lpxB PE=3 SV=1
Q39F56	3.94e-90	2	300	86	383	Lipid-A-disaccharide synthase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=lpxB PE=3 SV=1
B2JIB3	1.27e-88	9	300	93	383	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
Q13XC9	1.02e-87	9	300	93	383	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
Q470F0	1.06e-87	9	300	107	397	Lipid-A-disaccharide synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003023_00931.