CAZyme Information: MGYG000003018_01123

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_01123
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		70352.04	5.4929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 1005; End: 2885 Strand: +

Full Sequence      

MDNLKRKFLSVGAWACLLAVPAAAAPKSTTKAKPVPPSTHLEGYLGERINACIRGRVMSE
DESLLVAPFRQQNETNAWQSEFWGKWTLGAIASYRYNGDPELLQKIRNGVELMLETQLPD
GYIGNYAPEAQLTNWDVWGRKYTLLGLLAYYDLSGNKKVLEAARRLADHLLTQIPSQKSI
VEAGHYRGMPPSSILEPMVALYNRTGDKRYLDFAEYIVAQWETERGPRLISKALEDVPVS
QRFVPDTKQAAWWSWDNGQKAYEMMSCYDGLLDLYKITGKPEYLEAVQKTVRNIIDNEIN
IAGSGSAFECFYGGRAKQTRPTYHTMETCVTMTWMKLCRNLLELTHDPIYADQIERSAYN
ALCAALKDDASQIAKYSPLEGARSAGEEQCGMHVNCCNSNGPRAFAMLPEVAVTNTEDNI
YINLFGPSTSTVRLAGGEVNLTQTTTYPEEGTVEITVTPRKAFEFGISLRIPSWSETTMA
IVNGESIGNVRPGSYLDIRRRWTPEDKITLRLDMRGRLVELDGCQAIERGPVVLARDSRF
GDGYVDETAIVQTTDGYVTLLPVDDKPEKMWMAFTAPMVMGTDLEGEFAQPRQIGLCDFS
SAGNTWNKNIRYRVWLRKTLNVIFER

Enzyme Prediction     

No EC number prediction in MGYG000003018_01123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	74	534	4.2e-63	0.9064885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.79e-73	84	535	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.87e-60	27	535	4	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	5.98e-06	40	228	369	576	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	4.72e-05	86	215	553	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04792	LanM-like	1.84e-04	144	289	552	678	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	9.61e-204	41	625	29	615
AIQ29277.1	1.81e-44	53	557	37	602
QOY86860.1	4.74e-44	85	568	97	578
AXC10260.1	2.51e-43	85	536	133	592
AIQ52276.1	1.41e-42	53	533	41	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.22e-31	85	533	81	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.06e-30	89	571	78	576	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	9.67e-30	85	533	81	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.16e-28	79	538	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022228	0.658033	0.264191	0.049306	0.004941	0.001279

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_01123.