CAZyme Information: MGYG000003016_01917

Basic Information

• Species: Salinicola tamaricis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Halomonadaceae; Salinicola; Salinicola tamaricis
• CAZyme ID: MGYG000003016_01917
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34639.92	8.2712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003016	3944563	MAG	China	Asia

• Gene Location: Start: 12910; End: 13857 Strand: +

Full Sequence      

MAQSLFMTLKQRHPGATLGVVAPGWSLPILERMPEVDEAIALDVKHGEFGWRTRRELARQ
LKGRFDHAIVLPRSLKSALVPFLAGIPKRTGFTGEQRYWLINDRRQLDKGVLDQTVKRFV
ALGLDAQTSAHGDFPLPHPRLRVDAERQASLRETLDLGARPAIGMMPGAEYGPAKQWPLA
YFRELAQTLISQGHTVWILGGPKDVEAGETIVEGLEHARNLCGKTRLADAVDLLAACEQV
VTNDSGLMHVAAAVGTRIQALYGSSSPAYTPPLSDDAHIHYLALSCSPCFQRTCPLGHHD
CLRQLTPSLVLRAMQ

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	54	300	6.9e-58	0.9822222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02195	heptsyl_trn_II	1.63e-138	1	315	15	330	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	8.56e-111	1	315	16	340	ADP-heptose--LPS heptosyltransferase RfaF.
COG0859	RfaF	5.84e-81	1	313	17	325	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.27e-67	1	314	15	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	9.54e-66	54	298	1	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFU00028.1	6.22e-167	1	314	28	341
QJQ97428.1	6.68e-167	1	314	28	341
QPP49566.1	3.74e-165	1	314	24	337
AXY42794.1	1.82e-164	1	314	39	352
CBV40895.1	4.32e-164	1	315	23	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	5.40e-79	2	314	17	339	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	4.12e-11	9	272	32	297	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	9.00e-83	1	314	16	339	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	1.27e-82	1	314	16	339	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	2.22e-77	1	314	16	340	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003016_01917.