CAZyme Information: MGYG000003003_00352

Basic Information

• Species: CAG-1427 sp900539675
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900539675
• CAZyme ID: MGYG000003003_00352
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000003003_5|CGC1	40633.72	6.8744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003003	1845572	MAG	United States	North America

• Gene Location: Start: 7660; End: 8772 Strand: +

Full Sequence      

MNSESAAANTPLAGSNTAAGDATASSETAACDATASSSSAACHAQHTVSVVIPCYYSEKM
IAEVVHLTRKVLVEAGYDYEFVLTNDGSTDGTFAEIEKLHAEDPKVIGINLAKNFGQHSA
IMAGLRHATGDLVMLMDDDMQTHPSQCMKILKPMDDPADYDVVFATFPDHHEAWWRLLGS
RFTDWSMRVLTKRPKEIKSSNFLVMRGYIAKQITEYTGPYVYIQGLLFRATNRMLNVPVK
HFDREVGSSGYTLKSLIRLWSTVLNFSMAPLRFAAVIGAILGGLGVLGAILLIVQRVTDP
TIQQGWSSLMVTMLGCSGIVVLFLGLIGEYLGRLFMTINKAPQYVLREVIGGNEEVAPHD
TAEKRRRRSY

Enzyme Prediction     

No EC number prediction in MGYG000003003_00352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	195	4.8e-31	0.8411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04187	DPM1_like_bac	3.52e-51	50	228	1	177	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
PRK10714	PRK10714	1.48e-40	46	354	6	316	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional
cd04179	DPM_DPG-synthase_like	2.52e-40	50	194	1	147	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	8.72e-29	49	210	1	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	3.58e-25	47	296	4	251	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH00837.1	6.58e-155	48	360	4	311
ACV22462.1	4.38e-147	60	360	1	296
BCA89048.1	2.31e-144	48	350	3	303
BCS56850.1	9.36e-144	48	350	3	303
SOB73627.1	3.54e-88	49	362	4	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EKE_A	9.33e-30	49	351	29	331	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	1.79e-29	49	351	29	331	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5MLZ_A	1.71e-08	48	159	25	133	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ5	3.09e-41	48	364	10	325	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnC PE=3 SV=1
B7N5L9	1.61e-39	48	350	10	314	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnC PE=3 SV=1
B4ETL6	2.47e-39	48	351	10	315	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnC PE=3 SV=1
B1LLK8	3.14e-39	48	350	10	314	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=arnC PE=3 SV=1
B7NNT3	8.57e-39	48	350	10	314	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
273	295
310	332