CAZyme Information: MGYG000003000_00350

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_00350
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		48726.91	9.6649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 14720; End: 16051 Strand: -

Full Sequence      

MTTAPPVQNPTPNTTVAGKIALAALALTVVGWLIYIEFTGGLDFNVYRLGAMTIFDNEGM
HKDLYARDLLDYGALKLPFTYPPFAALLFVPFAFLPFGVGVGIMYTISIGVAWWMATLIY
DYATSRGYHIPFQDKLGRYGTIAVLTFIIILSGPWRRGLALVQVNPIILILVLADFLRPA
KRIPRGALIGIAGGIKLTPLAFGLILLMRKDWRGIFTLGASFAATVIIGFIFLPHEALTF
WTSAVSDPSRVGNINFLDNISIQGWLMHLGLRDPLLKPAYYGLVLATIVLFAALLHQLNR
RKLVLSQVAVGGFLMVSISPISWSHHNVMFPLILMALIVDAFPRFYAHLPAWANRAARIL
TWVALIGLYISPMWLGASLWGSFSDLDNIYQHALLFSTVPILCLYLVMITWAVAALTPAV
RTAEEDDLFIAPPPGAAPETKKG

Enzyme Prediction     

No EC number prediction in MGYG000003000_00350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	79	320	1.6e-63	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	2.97e-32	4	375	3	355	mannosyltransferase; Provisional
pfam09594	GT87	2.39e-28	79	320	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW92253.1	0.0	1	443	1	443
QQT88267.1	0.0	1	443	1	443
BAV86598.1	0.0	1	443	1	443
VEI24830.1	0.0	1	443	1	443
VEJ31066.1	1.28e-235	1	439	1	439

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	5.56e-25	22	335	25	340	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	5.56e-25	22	335	25	340	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	8.64e-25	30	365	35	378	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	3.98e-24	42	375	57	367	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	6.23e-19	42	375	69	380	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
93	115
136	155
185	207
214	233
279	296
303	323
328	347
359	378
393	415